Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DAXX blocking peptide

DAXX Peptide - C-terminal region

Gene Names
DAXX; DAP6; EAP1; BING2; SMIM40
Reactivity
Human
Applications
Western Blot
Synonyms
DAXX; DAXX Peptide - C-terminal region; DAXX blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHE
Sequence Length
710
Applicable Applications for DAXX blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DAXX blocking peptide
This is a synthetic peptide designed for use in combination with anti-DAXX Antibody, made

Target Description: This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination.
Product Categories/Family for DAXX blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
death domain-associated protein 6 isoform a
NCBI Official Synonym Full Names
death domain associated protein
NCBI Official Symbol
DAXX
NCBI Official Synonym Symbols
DAP6; EAP1; BING2; SMIM40
NCBI Protein Information
death domain-associated protein 6
UniProt Protein Name
Death domain-associated protein 6
UniProt Gene Name
DAXX
UniProt Synonym Gene Names
BING2; DAP6; hDaxx; EAP1
UniProt Entry Name
DAXX_HUMAN

NCBI Description

This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]

Uniprot Description

DAXX: a transcriptional co-regulatory protein. Proposed to mediate activation of the JNK pathway and apoptosis via ASK1 in response to signaling from FAS and TGF-betaR2. Glucose deprivation activates the ASK1-SEK1-JNK1-HIPK1 pathway, relocalizing Daxx from the nucleus to the cytoplasm, where Daxx binds to ASK1, and subsequently leads to ASK1 oligomerization. Interaction with HSP27 may prevent interaction with TGF-betaR2 and ASK1 and block DAXX-mediated apoptosis. Seems to act as a transcriptional co- repressor and inhibits PAX3 and ETS1 through direct protein- protein interaction. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively. Two alternatively spliced isoforms have been described.

Protein type: Apoptosis; Transcription, coactivator/corepressor; Nucleolus; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: heterochromatin; PML body; cytoplasm; nucleolus; nucleus; cytosol; chromosome, pericentric region

Molecular Function: protein homodimerization activity; histone binding; p53 binding; protein N-terminus binding; protein kinase binding; transcription factor binding; protein binding; enzyme binding; androgen receptor binding; heat shock protein binding; ubiquitin protein ligase binding; receptor signaling protein activity; protein kinase activator activity; transcription corepressor activity

Biological Process: viral reproduction; transcription, DNA-dependent; regulation of protein ubiquitination; apoptosis; activation of JNK activity; chromatin remodeling; nucleosome assembly; cytokinesis after mitosis; regulation of transcription, DNA-dependent; induction of apoptosis via death domain receptors; positive regulation of protein kinase activity; androgen receptor signaling pathway; positive regulation of protein amino acid phosphorylation; negative regulation of transcription, DNA-dependent

Research Articles on DAXX

Similar Products

Product Notes

The DAXX daxx (Catalog #AAA3239622) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DAXX Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAXX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAXX daxx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSSTSFNGGV SPHNWGDSGP PCKKSRKEKK QTGSGPLGNS YVERQRSVHE. It is sometimes possible for the material contained within the vial of "DAXX, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.