Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DAND5 blocking peptide

DAND5 Peptide - C-terminal region

Gene Names
DAND5; SP1; CER2; COCO; CRL2; CERL2; DANTE; GREM3; CKTSF1B3
Reactivity
Human
Applications
Western Blot
Synonyms
DAND5; DAND5 Peptide - C-terminal region; DAND5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
YIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEG
Sequence Length
189
Applicable Applications for DAND5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DAND5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DAND5 Antibody, made

Target Description: This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry.
Product Categories/Family for DAND5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
DAN domain family member 5
NCBI Official Synonym Full Names
DAN domain BMP antagonist family member 5
NCBI Official Symbol
DAND5
NCBI Official Synonym Symbols
SP1; CER2; COCO; CRL2; CERL2; DANTE; GREM3; CKTSF1B3
NCBI Protein Information
DAN domain family member 5
UniProt Protein Name
DAN domain family member 5
Protein Family
UniProt Gene Name
DAND5
UniProt Synonym Gene Names
CER2; CKTSF1B3; GREM3; SP1; Cerl-2
UniProt Entry Name
DAND5_HUMAN

NCBI Description

This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry. [provided by RefSeq, Jul 2008]

Uniprot Description

DAND5: Seems to play a role in the correct specification of the left-right axis. May antagonize NODAL and BMP4 signaling. Cystine knot-containing proteins play important roles during development, organogenesis, tissue growth and differentiation. Belongs to the DAN family.

Protein type: Secreted, signal peptide; Secreted; Cell development/differentiation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: extracellular region

Molecular Function: morphogen activity

Biological Process: negative regulation of transforming growth factor beta receptor signaling pathway; negative regulation of BMP signaling pathway

Research Articles on DAND5

Similar Products

Product Notes

The DAND5 dand5 (Catalog #AAA3242138) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DAND5 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DAND5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAND5 dand5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YIPGSDPTPL VLCNSCMPAR KRWAPVVLWC LTGSSASRRR VKISTMLIEG. It is sometimes possible for the material contained within the vial of "DAND5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.