Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CYP27B1 blocking peptide

CYP27B1 Peptide - C-terminal region

Gene Names
CYP27B1; VDR; CP2B; CYP1; PDDR; VDD1; VDDR; VDDRI; CYP27B; P450c1; CYP1alpha
Reactivity
Human
Synonyms
CYP27B1; CYP27B1 Peptide - C-terminal region; CYP27B1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGRRLAELEL
Sequence Length
508
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CYP27B1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CYP27B1 Antibody, made

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.
Product Categories/Family for CYP27B1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
NCBI Official Synonym Full Names
cytochrome P450 family 27 subfamily B member 1
NCBI Official Symbol
CYP27B1
NCBI Official Synonym Symbols
VDR; CP2B; CYP1; PDDR; VDD1; VDDR; VDDRI; CYP27B; P450c1; CYP1alpha
NCBI Protein Information
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
UniProt Protein Name
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
UniProt Gene Name
CYP27B1
UniProt Synonym Gene Names
CYP1ALPHA; CYP27B; VD3 1A hydroxylase
UniProt Entry Name
CP27B_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP27B1: Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. Defects in CYP27B1 are the cause of rickets vitamin D- dependent type 1A (VDDR1A); also known as pseudovitamin D deficiency rickets (PDDR). A disorder caused by a selective deficiency of the active form of vitamin D (1,25- dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Lipid Metabolism - steroid biosynthesis; Mitochondrial; EC 1.14.13.13; Cell cycle regulation

Chromosomal Location of Human Ortholog: 12q14.1

Cellular Component: cytoplasm; mitochondrial outer membrane; mitochondrion

Molecular Function: calcidiol 1-monooxygenase activity; heme binding; iron ion binding

Biological Process: bone mineralization; calcium ion homeostasis; calcium ion transport; decidualization; negative regulation of cell growth; negative regulation of cell proliferation; positive regulation of keratinocyte differentiation; regulation of bone mineralization; response to estrogen stimulus; response to lipopolysaccharide; response to vitamin D; vitamin D catabolic process; vitamin D metabolic process; vitamin metabolic process

Disease: Vitamin D Hydroxylation-deficient Rickets, Type 1a

Research Articles on CYP27B1

Similar Products

Product Notes

The CYP27B1 cyp27b1 (Catalog #AAA3246229) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CYP27B1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRDPAQFPEP NSFRPARWLG EGPTPHPFAS LPFGFGKRSC MGRRLAELEL. It is sometimes possible for the material contained within the vial of "CYP27B1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.