Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DDX11Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 3ug/ml)

Rabbit anti-Human DDX11 Polyclonal Antibody | anti-DDX11 antibody

DDX11 Antibody-N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DDX11; Polyclonal Antibody; DDX11 Antibody-N-terminal region; ATP-dependent DNA helicase DDX11; CHL1; KRG2; WABS; CHLR1; anti-DDX11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LGRCVVMVGMPFPNIRSAELQEKMAYLDQTLSPRPGTPREGSGGEPVHEG
Applicable Applications for anti-DDX11 antibody
Western Blot (WB)
Protein Size
970 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DDX11Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 3ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DDX11Sample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 3ug/ml)
Related Product Information for anti-DDX11 antibody
Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an enzyme that possesses both ATPase and DNA helicase activities. This gene is a homolog of the yeast CHL1 gene, and may function to maintain chromosome transmission fidelity and genome stability. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
106kDa
UniProt Protein Name
ATP-dependent DNA helicase DDX11
UniProt Gene Name
DDX11
UniProt Synonym Gene Names
KRG-2

Uniprot Description

DDX11: DNA helicase involved in cellular proliferation. Possesses DNA-dependent ATPase and helicase activities. This helicase translocates on single-stranded DNA in the 5' to 3' direction in the presence of ATP and, to a lesser extent, dATP. Its unwinding activity requires a 5'-single-stranded region for helicase loading, since flush-ended duplex structures do not support unwinding. The helicase activity is capable of displacing duplex regions up to 100 bp, which can be extended to 500 bp by RPA or the cohesion establishment factor, the Ctf18-RFC (replication factor C) complex activities. Stimulates the flap endonuclease activity of FEN1. Required for normal sister chromatid cohesion. Required for recruitment of bovine papillomavirus type 1 regulatory protein E2 to mitotic chrmosomes and for viral genome maintenance. Required for maintaining the chromosome segregation and is essential for embryonic development and the prevention of aneuploidy. May function during either S, G2, or M phase of the cell cycle. Binds to both single- and double-stranded DNA. Defects in DDX11 are the cause of Warsaw breakage syndrome (WBRS). It is a syndrome characterized by severe microcephaly, pre- and postnatal growth retardation, facial dysmorphism and abnormal skin pigmentation. Additional features include high arched palate, coloboma of the right optic disk, deafness, ventricular septal defect, toes and fingers abnormalities. At cellular level, drug-induced chromosomal breakage, a feature of Fanconi anemia, and sister chromatid cohesion defects, a feature of Roberts syndrome, coexist. Belongs to the DEAD box helicase family. DEAH subfamily. DDX11/CHL1 sub-subfamily. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.4.13; Helicase; Nucleolus

Chromosomal Location of Human Ortholog: 12p11.21

Cellular Component: centrosome; cytoplasm; fibrillar center; midbody; nuclear chromatin; nucleolus; nucleoplasm; nucleus; spindle pole

Molecular Function: 4 iron, 4 sulfur cluster binding; ATP binding; ATP-dependent DNA helicase activity; ATP-dependent helicase activity; chromatin binding; DNA binding; DNA replication origin binding; DNA-dependent ATPase activity; double-stranded DNA binding; G-quadruplex DNA binding; helicase activity; metal ion binding; protein binding; RNA-dependent ATPase activity; single-stranded DNA binding; single-stranded RNA binding; triplex DNA binding

Biological Process: cellular response to DNA damage stimulus; DNA duplex unwinding; DNA repair; multicellular organism development; negative regulation of protein binding; positive regulation of endodeoxyribonuclease activity; positive regulation of sister chromatid cohesion; replication fork processing; sister chromatid cohesion; transcription, DNA-dependent; viral process

Disease: Warsaw Breakage Syndrome

Similar Products

Product Notes

The DDX11 ddx11 (Catalog #AAA3249681) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX11 Antibody-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX11 ddx11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGRCVVMVGM PFPNIRSAEL QEKMAYLDQT LSPRPGTPRE GSGGEPVHEG. It is sometimes possible for the material contained within the vial of "DDX11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.