Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CYBRD1 blocking peptide

CYBRD1 Peptide - C-terminal region

Gene Names
CYBRD1; DCYTB; FRRS3; CYB561A2
Reactivity
Human
Synonyms
CYBRD1; CYBRD1 Peptide - C-terminal region; CYBRD1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Sequence Length
228
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CYBRD1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CYBRD1 Antibody, made

Target Description: This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption.
Product Categories/Family for CYBRD1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
cytochrome b reductase 1 isoform 2
NCBI Official Synonym Full Names
cytochrome b reductase 1
NCBI Official Symbol
CYBRD1
NCBI Official Synonym Symbols
DCYTB; FRRS3; CYB561A2
NCBI Protein Information
cytochrome b reductase 1
UniProt Protein Name
Cytochrome b reductase 1
Protein Family
UniProt Gene Name
CYBRD1
UniProt Synonym Gene Names
DCYTB; FRRS3
UniProt Entry Name
CYBR1_HUMAN

NCBI Description

This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption. [provided by RefSeq, Jul 2008]

Uniprot Description

CYBRD1: Ferric-chelate reductase that reduces Fe(3+) to Fe(2+). Present at the brush border of duodenal enterocytes where it probably reduces dietary Fe(3+) thereby facilitating its transport into the mucosal cells. Uses ascorbate as electron donor. May be involved in extracellular ascorbate recycling in erythrocyte membranes. May also act as a ferrireductase in airway epithelial cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Transporter; Transporter, ion channel; Motility/polarity/chemotaxis; Membrane protein, multi-pass; Transporter, iron; Oxidoreductase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: brush border membrane; integral to membrane; plasma membrane

Molecular Function: oxidoreductase activity, oxidizing metal ions; metal ion binding; ferric-chelate reductase activity

Biological Process: cellular iron ion homeostasis; response to iron ion; transmembrane transport

Research Articles on CYBRD1

Similar Products

Product Notes

The CYBRD1 cybrd1 (Catalog #AAA3246543) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CYBRD1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNGGTEQGAR GSMPAYSGNN MDKSDSELNS EVAARKRNLA LDEAGQRSTM. It is sometimes possible for the material contained within the vial of "CYBRD1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.