Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CYBRD1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Rabbit anti-Human CYBRD1 Polyclonal Antibody | anti-CYBRD1 antibody

CYBRD1 Rabbit pAb

Gene Names
CYBRD1; DCYTB; FRRS3; CYB561A2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
CYBRD1; Polyclonal Antibody; CYBRD1 Rabbit pAb; CYB561A2; anti-CYBRD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
IFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Applicable Applications for anti-CYBRD1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 215-286 of human CYBRD1 (NP_079119.3).
Positive Samples
HT-29, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using CYBRD1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using CYBRD1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-CYBRD1 antibody
Background: This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption.
Product Categories/Family for anti-CYBRD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,087 Da
NCBI Official Full Name
cytochrome b reductase 1 isoform 1
NCBI Official Synonym Full Names
cytochrome b reductase 1
NCBI Official Symbol
CYBRD1
NCBI Official Synonym Symbols
DCYTB; FRRS3; CYB561A2
NCBI Protein Information
cytochrome b reductase 1; duodenal cytochrome b; ferric-chelate reductase 3; cytochrome b561 family, member A2
UniProt Protein Name
Cytochrome b reductase 1
Protein Family
UniProt Gene Name
CYBRD1
UniProt Synonym Gene Names
DCYTB; FRRS3
UniProt Entry Name
CYBR1_HUMAN

NCBI Description

This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption. [provided by RefSeq, Jul 2008]

Uniprot Description

CYBRD1: Ferric-chelate reductase that reduces Fe(3+) to Fe(2+). Present at the brush border of duodenal enterocytes where it probably reduces dietary Fe(3+) thereby facilitating its transport into the mucosal cells. Uses ascorbate as electron donor. May be involved in extracellular ascorbate recycling in erythrocyte membranes. May also act as a ferrireductase in airway epithelial cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Transporter; Transporter, ion channel; Motility/polarity/chemotaxis; Membrane protein, multi-pass; Transporter, iron; Oxidoreductase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: brush border membrane; integral to membrane; plasma membrane

Molecular Function: oxidoreductase activity, oxidizing metal ions; metal ion binding; ferric-chelate reductase activity

Biological Process: cellular iron ion homeostasis; response to iron ion; transmembrane transport

Research Articles on CYBRD1

Similar Products

Product Notes

The CYBRD1 cybrd1 (Catalog #AAA9142665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYBRD1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYBRD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CYBRD1 cybrd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IFWIVTRPQW KRPKEPNSTI LHPNGGTEQG ARGSMPAYSG NNMDKSDSEL NSEVAARKRN LALDEAGQRS TM. It is sometimes possible for the material contained within the vial of "CYBRD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.