Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CY24B blocking peptide

CY24B Peptide - C-terminal region

Gene Names
CYBB; CGD; NOX2; IMD34; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX
Reactivity
Human
Applications
Western Blot
Synonyms
CY24B; CY24B Peptide - C-terminal region; CY24B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: YGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG
Sequence Length
570
Applicable Applications for CY24B blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CY24B blocking peptide
This is a synthetic peptide designed for use in combination with anti-CY24B Antibody, made

Target Description: Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole.
Product Categories/Family for CY24B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62 kDa
NCBI Official Full Name
cytochrome b-245 heavy chain
NCBI Official Synonym Full Names
cytochrome b-245 beta chain
NCBI Official Symbol
CYBB
NCBI Official Synonym Symbols
CGD; NOX2; IMD34; AMCBX2; GP91-1; GP91PHOX; p91-PHOX; GP91-PHOX
NCBI Protein Information
cytochrome b-245 heavy chain
UniProt Protein Name
Cytochrome b-245 heavy chain
UniProt Gene Name
CYBB
UniProt Synonym Gene Names
NOX2; Cytochrome b558 subunit beta
UniProt Entry Name
CY24B_HUMAN

NCBI Description

Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole. [provided by RefSeq, Jul 2008]

Uniprot Description

CYBB: Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. Defects in CYBB are a cause of granulomatous disease,chronic, X-linked (CGD). A disorder characterized by the inability of neutrophils and phagocytes to kill microbes that they have ingested. Patients suffer from life- threatening bacterial/fungal infections. Defects in CYBB are a cause of mycobacteriosis atypical X-linked type 2 (AMCBX2). A rare condition characterized by predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections.

Protein type: Oxidoreductase; Mitochondrial; EC 1.-.-.-; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xp21.1

Cellular Component: Golgi apparatus; phagocytic vesicle membrane; rough endoplasmic reticulum; cell soma; mitochondrion; integral to plasma membrane; dendrite; plasma membrane; NADPH oxidase complex

Molecular Function: protein binding; FAD binding; electron carrier activity; protein heterodimerization activity; metal ion binding; superoxide-generating NADPH oxidase activity; heme binding; voltage-gated ion channel activity

Biological Process: response to drug; respiratory burst; interaction with host; superoxide metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of peptide antigen via MHC class I; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; ion transport; vascular endothelial growth factor receptor signaling pathway; inflammatory response; superoxide release; hydrogen peroxide biosynthetic process; response to nutrient

Disease: Immunodeficiency 34; Granulomatous Disease, Chronic, X-linked

Research Articles on CY24B

Similar Products

Product Notes

The CY24B cybb (Catalog #AAA3232257) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CY24B Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CY24B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CY24B cybb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGRPNWDNEF KTIASQHPNT RIGVFLCGPE ALAETLSKQS ISNSESGPRG. It is sometimes possible for the material contained within the vial of "CY24B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.