Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CTSH blocking peptide

CTSH Peptide - C-terminal region

Gene Names
CTSH; ACC4; ACC5; CPSB; ACC-4; ACC-5
Reactivity
Human
Applications
Western Blot
Synonyms
CTSH; CTSH Peptide - C-terminal region; CTSH blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
DFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQW
Sequence Length
335
Applicable Applications for CTSH blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CTSH blocking peptide
This is a synthetic peptide designed for use in combination with anti-CTSH Antibody, made

Target Description: The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors.
Product Categories/Family for CTSH blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
pro-cathepsin H isoform a preproprotein
NCBI Official Synonym Full Names
cathepsin H
NCBI Official Symbol
CTSH
NCBI Official Synonym Symbols
ACC4; ACC5; CPSB; ACC-4; ACC-5
NCBI Protein Information
pro-cathepsin H
UniProt Protein Name
Pro-cathepsin H
Protein Family
UniProt Gene Name
CTSH
UniProt Synonym Gene Names
CPSB
UniProt Entry Name
CATH_HUMAN

NCBI Description

The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]

Uniprot Description

CTSH: Important for the overall degradation of proteins in lysosomes. Belongs to the peptidase C1 family.

Protein type: EC 3.4.22.16; Protease

Chromosomal Location of Human Ortholog: 15q25.1

Cellular Component: extracellular space; lysosome; acrosome; outer dense fiber; cytosol

Molecular Function: peptidase activity; protein binding; protein self-association; HLA-A specific activating MHC class I receptor activity; serine-type endopeptidase activity; cysteine-type endopeptidase activity; endopeptidase activity; protein complex binding; caspase activator activity; aminopeptidase activity; kininogen binding; cysteine-type peptidase activity

Biological Process: caspase activation; adaptive immune response; response to retinoic acid; protein destabilization; membrane protein proteolysis; proteolysis; antigen processing and presentation; positive regulation of angiogenesis; positive regulation of cell proliferation; zymogen activation; spermatogenesis; surfactant homeostasis; metanephros development; immune response-regulating signal transduction; positive regulation of cell migration; T cell mediated cytotoxicity; negative regulation of apoptosis

Research Articles on CTSH

Similar Products

Product Notes

The CTSH ctsh (Catalog #AAA3240890) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CTSH Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTSH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTSH ctsh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DFMMYRTGIY SSTSCHKTPD KVNHAVLAVG YGEKNGIPYW IVKNSWGPQW. It is sometimes possible for the material contained within the vial of "CTSH, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.