Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPAP2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit PLPP1 Polyclonal Antibody | anti-PLPP1 antibody

PLPP1 Antibody - N-terminal region

Gene Names
PLPP1; LPP1; PAP2; LLP1a; PAP-2a; PPAP2A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLPP1; Polyclonal Antibody; PLPP1 Antibody - N-terminal region; anti-PLPP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL
Sequence Length
284
Applicable Applications for anti-PLPP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPAP2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPAP2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PPAP2A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-PLPP1 antibody
This is a rabbit polyclonal antibody against PPAP2A. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
phospholipid phosphatase 1 isoform 1
NCBI Official Synonym Full Names
phospholipid phosphatase 1
NCBI Official Symbol
PLPP1
NCBI Official Synonym Symbols
LPP1; PAP2; LLP1a; PAP-2a; PPAP2A
NCBI Protein Information
phospholipid phosphatase 1
UniProt Protein Name
Lipid phosphate phosphohydrolase 1
Protein Family
UniProt Gene Name
PPAP2A
UniProt Synonym Gene Names
LPP1; PAP-2a; PAP2a
UniProt Entry Name
LPP1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

PPAP2A: Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids. Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system. Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA. May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation. It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P. It's down-regulation may contribute to the development of colon adenocarcinoma. Belongs to the PA-phosphatase related phosphoesterase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Lipid Metabolism - sphingolipid; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - ether lipid; Membrane protein, multi-pass; Lipid Metabolism - glycerolipid; Phosphatase (non-protein); EC 3.1.3.4

Chromosomal Location of Human Ortholog: 5q11

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: phosphatidate phosphatase activity

Biological Process: steroid hormone receptor signaling pathway; negative regulation of cell proliferation; regulation of lipid metabolic process; sphingolipid metabolic process; sphingolipid biosynthetic process; germ cell migration; protein kinase C activation; androgen receptor signaling pathway; lipid metabolic process; protein amino acid dephosphorylation; phospholipid dephosphorylation

Research Articles on PLPP1

Similar Products

Product Notes

The PLPP1 ppap2a (Catalog #AAA3206214) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLPP1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PLPP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLPP1 ppap2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QRGVFCNDES IKYPYKEDTI PYALLGGIII PFSIIVIILG ETLSVYCNLL. It is sometimes possible for the material contained within the vial of "PLPP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.