Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CTSD blocking peptide

CTSD Peptide - middle region

Gene Names
CTSD; CPSD; CLN10; HEL-S-130P
Reactivity
Human
Synonyms
CTSD; CTSD Peptide - middle region; CTSD blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: HHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASAL
Sequence Length
412
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CTSD blocking peptide
This is a synthetic peptide designed for use in combination with anti- CTSD Antibody, made

Target Description: This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease.
Product Categories/Family for CTSD blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
cathepsin D preproprotein
NCBI Official Synonym Full Names
cathepsin D
NCBI Official Symbol
CTSD
NCBI Official Synonym Symbols
CPSD; CLN10; HEL-S-130P
NCBI Protein Information
cathepsin D
UniProt Protein Name
Cathepsin D
Protein Family
UniProt Gene Name
CTSD
UniProt Synonym Gene Names
CPSD
UniProt Entry Name
CATD_HUMAN

NCBI Description

This gene encodes a member of the A1 family of peptidases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the cathepsin D light and heavy chains, which heterodimerize to form the mature enzyme. This enzyme exhibits pepsin-like activity and plays a role in protein turnover and in the proteolytic activation of hormones and growth factors. Mutations in this gene play a causal role in neuronal ceroid lipofuscinosis-10 and may be involved in the pathogenesis of several other diseases, including breast cancer and possibly Alzheimer's disease. [provided by RefSeq, Nov 2015]

Uniprot Description

CTSD: Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. Consists of a light chain and a heavy chain. Belongs to the peptidase A1 family.

Protein type: Protease; Autophagy; EC 3.4.23.5; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: extracellular matrix; lysosomal lumen; extracellular space; lysosome; melanosome; extracellular region

Molecular Function: protein binding; aspartic-type endopeptidase activity

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class II; proteolysis

Disease: Ceroid Lipofuscinosis, Neuronal, 10

Research Articles on CTSD

Similar Products

Product Notes

The CTSD ctsd (Catalog #AAA3247828) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CTSD Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: HHKYNSDKSS TYVKNGTSFD IHYGSGSLSG YLSQDTVSVP CQSASSASAL. It is sometimes possible for the material contained within the vial of "CTSD, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.