Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CDK5RAP3 blocking peptide

CDK5RAP3 Peptide - N-terminal region

Gene Names
CDK5RAP3; C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
Reactivity
Human
Applications
Western Blot
Synonyms
CDK5RAP3; CDK5RAP3 Peptide - N-terminal region; CDK5RAP3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCK
Sequence Length
506
Applicable Applications for CDK5RAP3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CDK5RAP3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CDK5RAP3 Antibody, made

Target Description: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in neuronal differentiation. The encoded protein, which may be a substrate of neuronal CDC2-like kinase, has also been found in vascular endothelial cells, where it mediates cell proliferation.
Product Categories/Family for CDK5RAP3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
CDK5 regulatory subunit-associated protein 3 isoform b
NCBI Official Synonym Full Names
CDK5 regulatory subunit associated protein 3
NCBI Official Symbol
CDK5RAP3
NCBI Official Synonym Symbols
C53; IC53; LZAP; HSF-27; MST016; PP1553; OK/SW-cl.114
NCBI Protein Information
CDK5 regulatory subunit-associated protein 3
UniProt Protein Name
CDK5 regulatory subunit-associated protein 3
Protein Family
UniProt Gene Name
CDK5RAP3
UniProt Synonym Gene Names
IC53
UniProt Entry Name
CK5P3_HUMAN

NCBI Description

This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm of chromosome 20. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

CDK5RAP3: Potential regulator of CDK5 activity. May be involved in cell proliferation. Regulates CDK5 activity via its interaction with CDK5R1. Belongs to the CDK5RAP3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: protein complex; membrane; cytoplasm; nucleolus; endomembrane system; nucleus

Molecular Function: cyclin binding; protein binding; protein kinase binding

Biological Process: cell proliferation; positive regulation of protein ubiquitination; inhibition of NF-kappaB transcription factor; regulation of neuron differentiation; regulation of mitotic cell cycle; positive regulation of transcription from RNA polymerase II promoter; brain development; regulation of cyclin-dependent protein kinase activity

Research Articles on CDK5RAP3

Similar Products

Product Notes

The CDK5RAP3 cdk5rap3 (Catalog #AAA3240326) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CDK5RAP3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5RAP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK5RAP3 cdk5rap3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLVRNVNYEI PSLKKQIAKC QQLQQEYSRK EEECQAGAAE MREQFYHSCK. It is sometimes possible for the material contained within the vial of "CDK5RAP3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.