Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-STAG2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellSTAG2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit STAG2 Polyclonal Antibody | anti-STAG2 antibody

STAG2 Antibody - C-terminal region

Gene Names
STAG2; SA2; SA-2; SCC3B; bA517O1.1
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STAG2; Polyclonal Antibody; STAG2 Antibody - C-terminal region; anti-STAG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS
Sequence Length
1231
Applicable Applications for anti-STAG2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-STAG2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellSTAG2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-STAG2 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellSTAG2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-STAG2 antibody
This is a rabbit polyclonal antibody against STAG2. It was validated on Western Blot

Target Description: STAG2 is a component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis.
Product Categories/Family for anti-STAG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
cohesin subunit SA-2 isoform b
NCBI Official Synonym Full Names
stromal antigen 2
NCBI Official Symbol
STAG2
NCBI Official Synonym Symbols
SA2; SA-2; SCC3B; bA517O1.1
NCBI Protein Information
cohesin subunit SA-2
UniProt Protein Name
Cohesin subunit SA-2
Protein Family
UniProt Gene Name
STAG2
UniProt Synonym Gene Names
SA2
UniProt Entry Name
STAG2_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the cohesin complex, which regulates the separation of sister chromatids during cell division. Targeted inactivation of this gene results in chromatid cohesion defects and aneuploidy, suggesting that genetic disruption of cohesin is a cause of aneuploidy in human cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

STAG2: Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis. Interacts directly with RAD21 in cohesin complex. Cohesin complexes are composed of a heterodimer between a SMC1 protein (SMC1A or SMC1B) and SMC3, which are attached via their hinge domain, and RAD21 which link them at their heads, and one STAG protein (STAG1, STAG2 or STAG3). In cohesin complexes, STAG2 is mutually exclusive with STAG1 and STAG3. Belongs to the SCC3 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xq25

Cellular Component: nucleoplasm; intermediate filament cytoskeleton; membrane; plasma membrane; nucleolus; chromosome; chromatin; nucleus; cytosol; chromosome, pericentric region; actin cytoskeleton

Molecular Function: protein binding; chromatin binding

Biological Process: mitosis; meiotic cell cycle; cell division; stem cell maintenance; sister chromatid cohesion; negative regulation of DNA endoreduplication; mitotic cell cycle

Research Articles on STAG2

Similar Products

Product Notes

The STAG2 stag2 (Catalog #AAA3216968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAG2 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STAG2 stag2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLAGGDDDTM SVISGISSRG STVRSKKSKP STGKRKVVEG MQLSLTEESS. It is sometimes possible for the material contained within the vial of "STAG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.