Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD99L2 blocking peptide

CD99L2 Peptide - middle region

Gene Names
CD99L2; CD99B; MIC2L1
Reactivity
Human
Applications
Western Blot
Synonyms
CD99L2; CD99L2 Peptide - middle region; CD99L2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
RNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPG
Sequence Length
213
Applicable Applications for CD99L2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CD99L2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CD99L2 Antibody, made

Target Description: The function remains unknown.
Product Categories/Family for CD99L2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
CD99 antigen-like protein 2 isoform 2
NCBI Official Synonym Full Names
CD99 molecule like 2
NCBI Official Symbol
CD99L2
NCBI Official Synonym Symbols
CD99B; MIC2L1
NCBI Protein Information
CD99 antigen-like protein 2
UniProt Protein Name
CD99 antigen-like protein 2
Protein Family
UniProt Gene Name
CD99L2
UniProt Synonym Gene Names
MIC2L1; UNQ1964/PRO4486
UniProt Entry Name
C99L2_HUMAN

NCBI Description

This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]

Uniprot Description

CD99L2: Plays a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Homophilic adhesion molecule, but these interactions may not be required for cell aggregation. Belongs to the CD99 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: focal adhesion; integral to membrane; plasma membrane

Biological Process: cell adhesion

Research Articles on CD99L2

Similar Products

Product Notes

The CD99L2 cd99l2 (Catalog #AAA3239810) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CD99L2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD99L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD99L2 cd99l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RNDRDDGRRK PIAGGGGFSD KDLEDIVGGG EYKPDKGKGD GRYGSNDDPG. It is sometimes possible for the material contained within the vial of "CD99L2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.