Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CSRP3 Antibody Titration: 0.125ug/mlPositive Control: Human muscle)

Rabbit CSRP3 Polyclonal Antibody | anti-CSRP3 antibody

CSRP3 antibody - C-terminal region

Gene Names
CSRP3; CLP; MLP; CRP3; LMO4; CMD1M; CMH12
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CSRP3; Polyclonal Antibody; CSRP3 antibody - C-terminal region; anti-CSRP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE
Sequence Length
194
Applicable Applications for anti-CSRP3 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CSRP3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CSRP3 Antibody Titration: 0.125ug/mlPositive Control: Human muscle)

Western Blot (WB) (WB Suggested Anti-CSRP3 Antibody Titration: 0.125ug/mlPositive Control: Human muscle)
Related Product Information for anti-CSRP3 antibody
This is a rabbit polyclonal antibody against CSRP3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This CSRP3 gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
cysteine and glycine-rich protein 3
NCBI Official Synonym Full Names
cysteine and glycine rich protein 3
NCBI Official Symbol
CSRP3
NCBI Official Synonym Symbols
CLP; MLP; CRP3; LMO4; CMD1M; CMH12
NCBI Protein Information
cysteine and glycine-rich protein 3
UniProt Protein Name
Cysteine and glycine-rich protein 3
UniProt Gene Name
CSRP3
UniProt Synonym Gene Names
CLP; MLP; CRP3
UniProt Entry Name
CSRP3_HUMAN

NCBI Description

This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CSRP3: Positive regulator of myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation. Defects in CSRP3 are the cause of cardiomyopathy dilated type 1M (CMD1M). Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Defects in CSRP3 are the cause of familial hypertrophic cardiomyopathy type 12 (CMH12). Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: cytoskeleton; nucleus; Z disc

Molecular Function: actinin binding; protein binding; telethonin binding; zinc ion binding; structural constituent of muscle

Biological Process: cardiac muscle development; cellular calcium ion homeostasis; skeletal muscle development; protein localization in organelle; cardiac myofibril assembly; positive regulation of transcription from RNA polymerase II promoter; regulation of the force of heart contraction; cardiac muscle contraction

Disease: Cardiomyopathy, Familial Hypertrophic, 12; Cardiomyopathy, Dilated, 1m

Research Articles on CSRP3

Similar Products

Product Notes

The CSRP3 csrp3 (Catalog #AAA3201912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSRP3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSRP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSRP3 csrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRCAICGKSL ESTNVTDKDG ELYCKVCYAK NFGPTGIGFG GLTQQVEKKE. It is sometimes possible for the material contained within the vial of "CSRP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.