Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BUB1B blocking peptide

BUB1B Peptide - N-terminal region

Gene Names
BUB1B; MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
Reactivity
Human
Synonyms
BUB1B; BUB1B Peptide - N-terminal region; BUB1B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQ
Sequence Length
933
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BUB1B blocking peptide
This is a synthetic peptide designed for use in combination with anti- BUB1B Antibody, made

Target Description: This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer.
Product Categories/Family for BUB1B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
701
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102 kDa
NCBI Official Full Name
mitotic checkpoint serine/threonine-protein kinase BUB1 beta
NCBI Official Synonym Full Names
BUB1 mitotic checkpoint serine/threonine kinase B
NCBI Official Symbol
BUB1B
NCBI Official Synonym Symbols
MVA1; SSK1; BUBR1; Bub1A; MAD3L; hBUBR1; BUB1beta
NCBI Protein Information
mitotic checkpoint serine/threonine-protein kinase BUB1 beta
UniProt Protein Name
Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
UniProt Gene Name
BUB1B
UniProt Synonym Gene Names
BUBR1; MAD3L; SSK1; hBUBR1
UniProt Entry Name
BUB1B_HUMAN

NCBI Description

This gene encodes a kinase involved in spindle checkpoint function. The protein has been localized to the kinetochore and plays a role in the inhibition of the anaphase-promoting complex/cyclosome (APC/C), delaying the onset of anaphase and ensuring proper chromosome segregation. Impaired spindle checkpoint function has been found in many forms of cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

BUB1B: Essential component of the mitotic checkpoint. Required for normal mitosis progression. The mitotic checkpoint delays anaphase until all chromosomes are properly attached to the mitotic spindle. One of its checkpoint functions is to inhibit the activity of the anaphase-promoting complex/cyclosome (APC/C) by blocking the binding of CDC20 to APC/C, independently of its kinase activity. The other is to monitor kinetochore activities that depend on the kinetochore motor CENPE. Required for kinetochore localization of CENPE. Negatively regulates PLK1 activity in interphase cells and suppresses centrosome amplification. Also implicated in triggering apoptosis in polyploid cells that exit aberrantly from mitotic arrest. May play a role for tumor suppression. Interacts with CENPE, CENPF, mitosin, PLK1 and BUB3. Part of a complex containing BUB3, CDC20 and BUB1B. Interacts with anaphase-promoting complex/cyclosome (APC/C). Interacts with CASC5. Induced during mitosis. Highly expressed in thymus followed by spleen. Preferentially expressed in tissues with a high mitotic index. Kinase activity stimulated by CENPE. Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. BUB1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; EC 2.7.11.1; Protein kinase, Other; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Other group; BUB family

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: kinetochore; anaphase-promoting complex; perinuclear region of cytoplasm; cytoplasm; microtubule organizing center; outer kinetochore of condensed chromosome; spindle midzone; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: cell proliferation; mitosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell division; apoptosis; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle checkpoint; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle; protein amino acid phosphorylation; mitotic metaphase/anaphase transition

Disease: Mosaic Variegated Aneuploidy Syndrome 1; Premature Chromatid Separation Trait

Research Articles on BUB1B

Similar Products

Product Notes

The BUB1B bub1b (Catalog #AAA3246371) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BUB1B Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFEYEIRFYT GNDPLDVWDR YISWTEQNYP QGGKESNMST LLERAVEALQ. It is sometimes possible for the material contained within the vial of "BUB1B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.