Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP1A1 blocking peptide

ATP1A1 Peptide - N-terminal region

Gene Names
ATP1A1; CMT2DD; HOMGSMR2
Reactivity
Human
Synonyms
ATP1A1; ATP1A1 Peptide - N-terminal region; ATP1A1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKY
Sequence Length
1023
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATP1A1 blocking peptide
The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 1 subunit. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for ATP1A1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
476
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
sodium/potassium-transporting ATPase subunit alpha-1 isoform a
NCBI Official Synonym Full Names
ATPase Na+/K+ transporting subunit alpha 1
NCBI Official Symbol
ATP1A1
NCBI Official Synonym Symbols
CMT2DD; HOMGSMR2
NCBI Protein Information
sodium/potassium-transporting ATPase subunit alpha-1
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit alpha-1
UniProt Gene Name
ATP1A1
UniProt Synonym Gene Names
Na(+)/K(+) ATPase alpha-1 subunit
UniProt Entry Name
AT1A1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 1 subunit. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]

Uniprot Description

ATP1A1: the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na and K ions across the plasma membrane. This action creates the electrochemical gradient of Na and K, providing the energy for active transport of various nutrients. Two splice-variant isoforms have been described.

Protein type: Membrane protein, integral; Transporter, ion channel; EC 3.6.3.9; Membrane protein, multi-pass; Hydrolase; Transporter

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: Golgi apparatus; protein complex; basolateral plasma membrane; endoplasmic reticulum; T-tubule; integral to membrane; caveola; membrane; apical plasma membrane; plasma membrane; melanosome; sodium:potassium-exchanging ATPase complex; sarcolemma; endosome; vesicle

Molecular Function: potassium ion binding; protein domain specific binding; protein binding; sodium ion binding; chaperone binding; phosphoric monoester hydrolase activity; sodium:potassium-exchanging ATPase activity; phosphoinositide 3-kinase binding; ankyrin binding; ADP binding; protein kinase binding; ATP binding

Biological Process: response to drug; cellular sodium ion homeostasis; negative regulation of heart contraction; membrane hyperpolarization; positive regulation of striated muscle contraction; regulation of sodium ion transport; cellular potassium ion homeostasis; negative regulation of glucocorticoid biosynthetic process; dephosphorylation; potassium ion import; regulation of blood pressure; positive regulation of heart contraction; transmembrane transport; regulation of the force of heart contraction; cardiac muscle contraction

Research Articles on ATP1A1

Similar Products

Product Notes

The ATP1A1 atp1a1 (Catalog #AAA3245002) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATP1A1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRDKYEPAAV SEQGDKKGKK GKKDRDMDEL KKEVSMDDHK LSLDELHRKY. It is sometimes possible for the material contained within the vial of "ATP1A1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.