Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATF1 blocking peptide

ATF1 Peptide - N-terminal region

Gene Names
ATF1; TREB36; EWS-ATF1; FUS/ATF-1
Reactivity
Human
Applications
Western Blot
Synonyms
ATF1; ATF1 Peptide - N-terminal region; ATF1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ
Sequence Length
271
Applicable Applications for ATF1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ATF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ATF1 Antibody, made

Target Description: ATF1 binds the cAMP response element (CRE) (consensus: 5'-GTGACGT [AC] [AG]-3'), a sequence present in many viral and cellular promoters. ATF1 binds to the Tax-responsive element (TRE) of HTLV-I. ATF1 mediates PKA-induced stimulation of CRE-reporter genes.
Product Categories/Family for ATF1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
466
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Synonym Full Names
activating transcription factor 1
NCBI Official Symbol
ATF1
NCBI Official Synonym Symbols
TREB36; EWS-ATF1; FUS/ATF-1
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-1
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-1
UniProt Gene Name
ATF1
UniProt Synonym Gene Names
cAMP-dependent transcription factor ATF-1
UniProt Entry Name
ATF1_HUMAN

NCBI Description

This gene encodes an activating transcription factor, which belongs to the ATF subfamily and bZIP (basic-region leucine zipper) family. It influences cellular physiologic processes by regulating the expression of downstream target genes, which are related to growth, survival, and other cellular activities. This protein is phosphorylated at serine 63 in its kinase-inducible domain by serine/threonine kinases, cAMP-dependent protein kinase A, calmodulin-dependent protein kinase I/II, mitogen- and stress-activated protein kinase and cyclin-dependent kinase 3 (cdk-3). Its phosphorylation enhances its transactivation and transcriptional activities, and enhances cell transformation. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in angiomatoid fibrous histiocytoma and clear cell sarcoma. This gene has a pseudogene on chromosome 6. [provided by RefSeq, Aug 2010]

Uniprot Description

ATF-1: a transcription factor that is a member of the leucine zipper family. Forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. Binds the Tax-responsive element (TRE) of HTLV-I. Activated downstream of IL-1. c-Src and TRAF6 are mediators of IL-1-induced AP-1 activation. Plays an important role in the trans-activation of the MHC class II trans-activator (CIITA) promoter III in B cells.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; protein heterodimerization activity; protein complex binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; response to organic cyclic substance; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; cellular protein complex assembly; response to cobalt ion; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; toll-like receptor 4 signaling pathway; positive regulation of DNA replication

Research Articles on ATF1

Similar Products

Product Notes

The ATF1 atf1 (Catalog #AAA3225450) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ATF1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATF1 atf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLSSEDTRGR KGDGENSGVS AAVTSMSVPT PIYQTSSGQY IAIAPNGALQ. It is sometimes possible for the material contained within the vial of "ATF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.