Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ASRGL1 blocking peptide

ASRGL1 Peptide - middle region

Gene Names
ASRGL1; ALP; ALP1; CRASH
Reactivity
Human
Synonyms
ASRGL1; ASRGL1 Peptide - middle region; ASRGL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVG
Sequence Length
308
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ASRGL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- ASRGL1 Antibody, made

Target Description: Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.
Product Categories/Family for ASRGL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
isoaspartyl peptidase/L-asparaginase
NCBI Official Synonym Full Names
asparaginase like 1
NCBI Official Symbol
ASRGL1
NCBI Official Synonym Symbols
ALP; ALP1; CRASH
NCBI Protein Information
isoaspartyl peptidase/L-asparaginase
UniProt Protein Name
Isoaspartyl peptidase/L-asparaginase
UniProt Gene Name
ASRGL1
UniProt Synonym Gene Names
ALP; CRASH
UniProt Entry Name
ASGL1_HUMAN

Uniprot Description

ASRGL1: Acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Belongs to the Ntn-hydrolase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; EC 3.4.19.5; EC 3.5.1.1; Energy Metabolism - nitrogen; Hydrolase; Other Amino Acids Metabolism - cyanoamino acid

Chromosomal Location of Human Ortholog: 11q12.3

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: asparaginase activity; beta-aspartyl-peptidase activity; N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity

Biological Process: asparagine catabolic process via L-aspartate; L-phenylalanine catabolic process

Research Articles on ASRGL1

Similar Products

Product Notes

The ASRGL1 asrgl1 (Catalog #AAA3246739) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ASRGL1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAAQFAAAMG VPEIPGEKLV TERNKKRLEK EKHEKGAQKT DCQKNLGTVG. It is sometimes possible for the material contained within the vial of "ASRGL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.