Immunoprecipitation (IP)
(Immunoprecipitation of ASRGL1 transfected lysate using ASRGL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with ASRGL1 mouse polyclonal antibody.)
Rabbit anti-Human ASRGL1 Polyclonal Antibody | anti-ASRGL1 antibody
ASRGL1 (Isoaspartyl Peptidase/L-asparaginase, Asparaginase-like Protein 1, Beta-aspartyl-peptidase, Isoaspartyl dipeptidase, L-asparagine Amidohydrolase, ALP, CRASH, FLJ22316)
Gene Names
ASRGL1; ALP; ALP1; CRASH
Reactivity
Human
Applications
Immunoprecipitation
Purity
SerumSerum
Synonyms
ASRGL1; Polyclonal Antibody; ASRGL1 (Isoaspartyl Peptidase/L-asparaginase; Asparaginase-like Protein 1; Beta-aspartyl-peptidase; Isoaspartyl dipeptidase; L-asparagine Amidohydrolase; ALP; CRASH; FLJ22316); Anti -ASRGL1 (Isoaspartyl Peptidase/L-asparaginase; anti-ASRGL1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ASRGL1.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP
Applicable Applications for anti-ASRGL1 antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human ASRGL1, aa1-308 (NP_001077395.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunoprecipitation (IP)
(Immunoprecipitation of ASRGL1 transfected lysate using ASRGL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with ASRGL1 mouse polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of ASRGL1 transfected lysate using ASRGL1 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with ASRGL1 mouse polyclonal antibody.)
Related Product Information for anti-ASRGL1 antibody
Has both L-asparaginase and beta-aspartyl peptidase activity. May be involved in the production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Is highly active with L-Asp beta-methyl ester. Besides, has catalytic activity toward beta-aspartyl dipeptides and their methyl esters, including beta-L-Asp-L-Phe, beta-L-Asp-L-Phe methyl ester (aspartame), beta-L-Asp-L-Ala, beta-L-Asp-L-Leu and beta-L-Asp-L-Lys. Does not have aspartylglucosaminidase activity and is inactive toward GlcNAc-L-Asn. Likewise, has no activity toward glutamine.
Product Categories/Family for anti-ASRGL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
32,055 Da
NCBI Official Full Name
ASRGL1 protein
NCBI Official Synonym Full Names
asparaginase like 1
NCBI Official Symbol
ASRGL1
NCBI Official Synonym Symbols
ALP; ALP1; CRASH
NCBI Protein Information
isoaspartyl peptidase/L-asparaginase; beta-aspartyl-peptidase; isoaspartyl dipeptidase; L-asparagine amidohydrolase; asparaginase-like 1 protein; asparaginase-like protein 1
UniProt Protein Name
Isoaspartyl peptidase/L-asparaginase
Protein Family
UniProt Gene Name
ASRGL1
UniProt Synonym Gene Names
ALP; CRASH
UniProt Entry Name
ASGL1_HUMAN
Uniprot Description
ASRGL1: Acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions. Belongs to the Ntn-hydrolase family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Other Amino Acids Metabolism - cyanoamino acid; EC 3.5.1.1; Hydrolase; EC 3.4.19.5; Amino Acid Metabolism - alanine, aspartate and glutamate; Energy Metabolism - nitrogen
Chromosomal Location of Human Ortholog: 11q12.3
Cellular Component: cytoplasm; nucleus
Molecular Function: N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity; asparaginase activity; beta-aspartyl-peptidase activity
Biological Process: asparagine catabolic process via L-aspartate; proteolysis
Research Articles on ASRGL1
Similar Products
Product Notes
The ASRGL1 asrgl1 (Catalog #AAA641290) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ASRGL1 (Isoaspartyl Peptidase/L-asparaginase, Asparaginase-like Protein 1, Beta-aspartyl-peptidase, Isoaspartyl dipeptidase, L-asparagine Amidohydrolase, ALP, CRASH, FLJ22316) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASRGL1 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the ASRGL1 asrgl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNPIVVVHGG GAGPISKDRK ERVHQGMVRA ATVGYGILRE GGSAVDAVEG AVVALEDDPE FNAGCGSVLN TNGEVEMDAS IMDGKDLSAG AVSAVQCIAN PIKLARLVME KTPHCFLTDQ GAAQFAAAMG VPEIPGEKLV TERNKKRLEK EKHEKGAQKT DCQKNLGTVG AVALDCKGNV AYATSTGGIV NKMVGRVGDS PCLGAGGYAD NDIGAVSTTG HGESILKVNL ARLTLFHIEQ GKTVEEAADL SLGYMKSRVK GLGGLIVVSK TGDWVAKWTS TSMPWAAAKD GKLHFGIDPD DTTITDLP. It is sometimes possible for the material contained within the vial of "ASRGL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
