Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ADPRHL2 blocking peptide

ADPRHL2 Peptide - C-terminal region

Gene Names
ADPRHL2; ARH3; CONDSIAS
Reactivity
Human
Applications
Western Blot
Synonyms
ADPRHL2; ADPRHL2 Peptide - C-terminal region; ADPRHL2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV
Sequence Length
363
Applicable Applications for ADPRHL2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ADPRHL2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ADPRHL2 Antibody, made

Target Description: This gene encodes a member of the ADP
Product Categories/Family for ADPRHL2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
ADP-ribose glycohydrolase ARH3
NCBI Official Synonym Full Names
ADP-ribosylhydrolase like 2
NCBI Official Symbol
ADPRHL2
NCBI Official Synonym Symbols
ARH3; CONDSIAS
NCBI Protein Information
ADP-ribose glycohydrolase ARH3; poly(ADP-ribose) glycohydrolase ARH3
UniProt Protein Name
Poly(ADP-ribose) glycohydrolase ARH3
UniProt Gene Name
ADPRHL2
UniProt Synonym Gene Names
ARH3
UniProt Entry Name
ARHL2_HUMAN

NCBI Description

This gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasm.[provided by RefSeq, Feb 2009]

Uniprot Description

ADPRHL2: Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism may be required for maintenance of the normal function of neuronal cells. Generates ADP-ribose from poly-(ADP-ribose), but does not hydrolyze ADP- ribose-arginine, -cysteine, -diphthamide, or -asparagine bonds. Belongs to the ADP-ribosylglycohydrolase family.

Protein type: EC 3.2.1.143; Hydrolase

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: nucleoplasm; mitochondrial matrix

Molecular Function: metal ion binding; poly(ADP-ribose) glycohydrolase activity

Biological Process: metabolic process

Research Articles on ADPRHL2

Similar Products

Product Notes

The ADPRHL2 adprhl2 (Catalog #AAA3242035) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ADPRHL2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADPRHL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADPRHL2 adprhl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SVLDARELGM EERPYSSRLK KIGELLDQAS VTREEVVSEL GNGIAAFESV. It is sometimes possible for the material contained within the vial of "ADPRHL2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.