Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (HOXC12 monoclonal antibody (M07), clone 2A4 Western Blot analysis of HOXC12 expression in Jurkat (Cat # L017V1).)

Mouse HOXC12 Monoclonal Antibody | anti-HOXC12 antibody

HOXC12 (Homeobox C12, HOC3F, HOX3, HOX3F) (PE)

Gene Names
HOXC12; HOX3; HOC3F; HOX3F
Applications
Western Blot
Purity
Purified
Synonyms
HOXC12; Monoclonal Antibody; HOXC12 (Homeobox C12; HOC3F; HOX3; HOX3F) (PE); Homeobox C12; HOX3F; anti-HOXC12 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A4
Specificity
Recognizes HOXC12.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HOXC12 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXC12 (NP_776272, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(HOXC12 monoclonal antibody (M07), clone 2A4 Western Blot analysis of HOXC12 expression in Jurkat (Cat # L017V1).)

Western Blot (WB) (HOXC12 monoclonal antibody (M07), clone 2A4 Western Blot analysis of HOXC12 expression in Jurkat (Cat # L017V1).)

Testing Data

(Detection limit for recombinant GST tagged HOXC12 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOXC12 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in NIH/3T3.)

Western Blot (WB) (HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in NIH/3T3.)

Western Blot (WB)

(HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in PC-12.)

Western Blot (WB) (HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in PC-12.)

Western Blot (WB)

(HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in Raw 264.7.)

Western Blot (WB) (HOXC12 monoclonal antibody (M07), clone 2A4. Western Blot analysis of HOXC12 expression in Raw 264.7.)
Related Product Information for anti-HOXC12 antibody
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq]
Product Categories/Family for anti-HOXC12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
homeobox protein Hox-C12
NCBI Official Synonym Full Names
homeobox C12
NCBI Official Symbol
HOXC12
NCBI Official Synonym Symbols
HOX3; HOC3F; HOX3F
NCBI Protein Information
homeobox protein Hox-C12
UniProt Protein Name
Homeobox protein Hox-C12
Protein Family
UniProt Gene Name
HOXC12
UniProt Synonym Gene Names
HOC3F; HOX3F
UniProt Entry Name
HXC12_HUMAN

NCBI Description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. [provided by RefSeq, Jul 2008]

Uniprot Description

HOXC12: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Abd-B homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; multicellular organismal development

Research Articles on HOXC12

Similar Products

Product Notes

The HOXC12 hoxc12 (Catalog #AAA6184169) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXC12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXC12 hoxc12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXC12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.