Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ADGRE1 blocking peptide

ADGRE1 Peptide - C-terminal region

Gene Names
ADGRE1; EMR1; TM7LN3
Reactivity
Human
Applications
Western Blot
Synonyms
ADGRE1; ADGRE1 Peptide - C-terminal region; ADGRE1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
Sequence Length
886
Applicable Applications for ADGRE1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ADGRE1 blocking peptide
This gene encodes a protein that has a domain resembling seven transmembrane G protein-coupled hormone receptors (7TM receptors) at its C-terminus. The N-terminus of the encoded protein has six EGF-like modules, separated from the transmembrane segments by a serine/threonine-rich domain, a feature reminiscent of mucin-like, single-span, integral membrane glycoproteins with adhesive properties. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for ADGRE1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
2kDa
NCBI Official Full Name
adhesion G protein-coupled receptor E1 isoform 1
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E1
NCBI Official Symbol
ADGRE1
NCBI Official Synonym Symbols
EMR1; TM7LN3
NCBI Protein Information
adhesion G protein-coupled receptor E1
UniProt Protein Name
EGF-like module-containing mucin-like hormone receptor-like 1
UniProt Gene Name
EMR1
UniProt Synonym Gene Names
TM7LN3
UniProt Entry Name
EMR1_HUMAN

NCBI Description

This gene encodes a protein that has a domain resembling seven transmembrane G protein-coupled hormone receptors (7TM receptors) at its C-terminus. The N-terminus of the encoded protein has six EGF-like modules, separated from the transmembrane segments by a serine/threonine-rich domain, a feature reminiscent of mucin-like, single-span, integral membrane glycoproteins with adhesive properties. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

EMR1: Could be involved in cell-cell interactions. Belongs to the G-protein coupled receptor 2 family. LN-TM7 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; GPCR, family 2; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: integral to plasma membrane; external side of plasma membrane

Molecular Function: G-protein coupled receptor activity; calcium ion binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell adhesion

Research Articles on ADGRE1

Similar Products

Product Notes

The ADGRE1 emr1 (Catalog #AAA3241307) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ADGRE1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADGRE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADGRE1 emr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GAFIFLIHCL LNGQVREEYK RWITGKTKPS SQSQTSRILL SSMPSASKTG. It is sometimes possible for the material contained within the vial of "ADGRE1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.