5-hydroxytryptamine receptor 3E (HTR3E) Recombinant Protein | HTR3E recombinant protein
Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E), partial
Gene Names
HTR3E; 5-HT3E; 5-HT3-E; 5-HT3c1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 3E (HTR3E); Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E); partial; HTR3E recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-456
Sequence
VTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISFAMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
Sequence Length
456
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,700 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 3E isoform d
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3E
NCBI Official Symbol
HTR3E
NCBI Official Synonym Symbols
5-HT3E; 5-HT3-E; 5-HT3c1
NCBI Protein Information
5-hydroxytryptamine receptor 3E
UniProt Protein Name
5-hydroxytryptamine receptor 3E
Protein Family
UniProt Gene Name
HTR3E
UniProt Synonym Gene Names
5-HT3-E; 5-HT3E
NCBI Description
This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Feb 2012]
Uniprot Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Research Articles on HTR3E
Similar Products
Product Notes
The HTR3E htr3e (Catalog #AAA1072217) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-456. The amino acid sequence is listed below: VTFTINCSGF GQHGADPTAL NSVFNRKPFR PVTNISVPTQ VNISFAMSAI LDVNEQLHLL SSFLWLEMVW DNPFISWNPE ECEGITKMSM AAKNLWLPDI FIIELMDVDK TPKGLTAYVS NEGRIRYKKP MKVDSICNLD IFYFPFDQQN CTLTFSSFLY TVDSMLLDME KEVWEITDAS RNILQTHGEW ELLGLSKATA KLSRGGNLYD QIVFYVAIRR RPSLYVINLL VPSGFLVAID ALSFYLPVKS GNRVPFKITL LLGYNVFLLM MSDLLPTSGT PLIGVYFALC LSLMVGSLLE TIFITHLLHV ATTQPPPLPR WLHSLLLHCN SPGRCCPTAP QKENKGPGLT PTHLPGVKEP EVSAGQMPGP AEAELTGGSE WTRAQREHEA QKQHSVELWL QFSHAMDAML FRLYLLFMAS SIITVICLWN T. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 3E (HTR3E), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
