Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

5-hydroxytryptamine receptor 3E (HTR3E) Recombinant Protein | HTR3E recombinant protein

Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E)

Gene Names
HTR3E; 5-HT3E; 5-HT3-E; 5-HT3c1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 3E (HTR3E); Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E); HTR3E recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
72-228aa&241-456aa; Partial
Sequence
MSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVPFKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHSVELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

SDS-PAGE
Related Product Information for HTR3E recombinant protein
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.
Product Categories/Family for HTR3E recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58.2 kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 3E isoform d
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3E
NCBI Official Symbol
HTR3E
NCBI Official Synonym Symbols
5-HT3E; 5-HT3-E; 5-HT3c1
NCBI Protein Information
5-hydroxytryptamine receptor 3E
UniProt Protein Name
5-hydroxytryptamine receptor 3E
UniProt Gene Name
HTR3E
UniProt Synonym Gene Names
5-HT3-E; 5-HT3E
UniProt Entry Name
5HT3E_HUMAN

NCBI Description

This locus encodes a 5-hydroxytryptamine (serotonin) receptor subunit. The encoded protein, subunit E, may play a role in neurotransmission in myenteric neurons. Genes encoding subunits C, D and E form a cluster on chromosome 3. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Feb 2012]

Uniprot Description

5-HT(3E): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3E sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Channel, cation; Channel, ligand-gated; Transporter, ion channel

Chromosomal Location of Human Ortholog: 3q27.1

Cellular Component: nicotinic acetylcholine-gated receptor-channel complex; plasma membrane

Molecular Function: acetylcholine binding; acetylcholine receptor activity; nicotinic acetylcholine-activated cation-selective channel activity; protein binding; serotonin receptor activity; serotonin-activated cation-selective channel activity

Biological Process: serotonin receptor signaling pathway; synaptic transmission, cholinergic

Research Articles on HTR3E

Similar Products

Product Notes

The HTR3E htr3e (Catalog #AAA7017305) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 72-228aa&241-456aa; Partial. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the HTR3E htr3e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSAILDVNEQ LHLLSSFLWL EMVWDNPFIS WNPEECEGIT KMSMAAKNLW LPDIFIIELM DVDKTPKGLT AYVSNEGRIR YKKPMKVDSI CNLDIFYFPF DQQNCTLTFS SFLYTVDSML LDMEKEVWEI TDASRNILQT HGEWELLGLS KATAKLSRVA IRRRPSLYVI NLLVPSGFLV AIDALSFYLP VKSGNRVPFK ITLLLGYNVF LLMMSDLLPT SGTPLIGVYF ALCLSLMVGS LLETIFITHL LHVATTQPPP LPRWLHSLLL HCNSPGRCCP TAPQKENKGP GLTPTHLPGV KEPEVSAGQM PGPAEAELTG GSEWTRAQRE HEAQKQHSVE LWLQFSHAMD AMLFRLYLLF MASSIITVIC LWNT. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 3E (HTR3E), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.