Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 2B (Htr2b) Recombinant Protein | Htr2b recombinant protein

Recombinant Rat 5-hydroxytryptamine receptor 2B (Htr2b)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 2B (Htr2b); Recombinant Rat 5-hydroxytryptamine receptor 2B (Htr2b); Htr2b recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-479aa; Full length protein
Sequence
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLI FAVIIPTIGGNILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATW PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWL ISIGIAIPVPIKGIEADVVNAHNITCELTKDRFGSFMLFGSLAAFFAPLTIMIVTYFLTI HALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKMVMLDGSHKDKILPNSTDETL MRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCDSCNQTTLKTL LQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Htr2b recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,652 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 2B
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 2B
NCBI Official Symbol
Htr2b
NCBI Protein Information
5-hydroxytryptamine receptor 2B
UniProt Protein Name
5-hydroxytryptamine receptor 2B
UniProt Gene Name
Htr2b
UniProt Synonym Gene Names
Srl; 5-HT-2B; 5-HT2B
UniProt Entry Name
5HT2B_RAT

NCBI Description

G-protein coupled receptor for serotonin [RGD, Feb 2006]

Uniprot Description

5-HT(2B): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Plays a role in the regulation of impulsive behavior. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Cellular Component: cell junction; cell soma; cytoplasm; dendrite; integral to plasma membrane; membrane; plasma membrane; synapse

Molecular Function: drug binding; G-protein alpha-subunit binding; GTPase activator activity; protein binding; serotonin binding; serotonin receptor activity

Biological Process: calcium-mediated signaling; cellular calcium ion homeostasis; cGMP biosynthetic process; embryonic morphogenesis; G-protein coupled receptor internalization; G-protein coupled receptor protein signaling pathway; heart development; heart morphogenesis; inositol phosphate metabolic process; intestine smooth muscle contraction; negative regulation of apoptosis; negative regulation of autophagy; neural crest cell differentiation; neural crest cell migration; phosphoinositide 3-kinase cascade; phospholipase C activation; phosphorylation; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of cytokine production; positive regulation of cytokine secretion; positive regulation of endothelial cell proliferation; positive regulation of GTPase activity; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of MAP kinase activity; positive regulation of nitric-oxide synthase activity; positive regulation of phosphatidylinositol biosynthetic process; protein kinase C activation; regulation of behavior; release of sequestered calcium ion into cytosol; response to drug; serotonin receptor signaling pathway; vasoconstriction

Research Articles on Htr2b

Similar Products

Product Notes

The Htr2b htr2b (Catalog #AAA7017290) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-479aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Htr2b htr2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSYKMSEQ STISEHILQK TCDHLILTDR SGLKAESAAE EMKQTAENQG NTVHWAALLI FAVIIPTIGG NILVILAVSL EKRLQYATNY FLMSLAVADL LVGLFVMPIA LLTIMFEATW PLPLALCPAW LFLDVLFSTA SIMHLCAISL DRYIAIKKPI QANQCNSRTT AFVKITVVWL ISIGIAIPVP IKGIEADVVN AHNITCELTK DRFGSFMLFG SLAAFFAPLT IMIVTYFLTI HALRKKAYLV RNRPPQRLTR WTVSTVLQRE DSSFSSPEKM VMLDGSHKDK ILPNSTDETL MRRMSSAGKK PAQTISNEQR ASKVLGIVFL FFLLMWCPFF ITNVTLALCD SCNQTTLKTL LQIFVWVGYV SSGVNPLIYT LFNKTFREAF GRYITCNYQA TKSVKVLRKC SSTLYFGNSM VENSKFFTKH GIRNGINPAM YQSPVRLRSS TIQSSSIILL NTFLTENDGD KVEDQVSYI. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 2B (Htr2b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.