Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ETV7 expression in transfected 293T cell line by ETV7 polyclonal antibody. Lane 1: ETV7 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human ETV7 Polyclonal Antibody | anti-ETV7 antibody

ETV7 (Transcription Factor ETV7, ETS Translocation Variant 7, ETS-related Protein Tel2, Tel-related Ets Factor, Transcription Factor Tel-2, TEL2, TELB, TREF) APC

Gene Names
ETV7; TEL2; TELB; TEL-2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ETV7; Polyclonal Antibody; ETV7 (Transcription Factor ETV7; ETS Translocation Variant 7; ETS-related Protein Tel2; Tel-related Ets Factor; Transcription Factor Tel-2; TEL2; TELB; TREF) APC; anti-ETV7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ETV7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
341
Applicable Applications for anti-ETV7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ETV7, aa1-341 (NP_057219.1).
Immunogen Sequence
MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ETV7 expression in transfected 293T cell line by ETV7 polyclonal antibody. Lane 1: ETV7 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ETV7 expression in transfected 293T cell line by ETV7 polyclonal antibody. Lane 1: ETV7 transfected lysate (39kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ETV7 antibody
Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.
Product Categories/Family for anti-ETV7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
transcription factor ETV7 isoform 1
NCBI Official Synonym Full Names
ETS variant transcription factor 7
NCBI Official Symbol
ETV7
NCBI Official Synonym Symbols
TEL2; TELB; TEL-2
NCBI Protein Information
transcription factor ETV7
UniProt Protein Name
Transcription factor ETV7
Protein Family
UniProt Gene Name
ETV7
UniProt Synonym Gene Names
TEL2; TELB; TREF
UniProt Entry Name
ETV7_HUMAN

NCBI Description

The protein encoded by this gene belongs to the ETS family of transcription factors, which is a large group of evolutionarily conserved transcriptional regulators that play an important role in a variety of cellular processes throughout development and differentiation, and are involved in oncogenesis as well. This protein is predominantly expressed in hematopoietic tissues. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene (PMID:11108721).[provided by RefSeq, May 2011]

Uniprot Description

ETV7: Transcriptional repressor; binds to the DNA sequence 5'- CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity. Belongs to the ETS family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; organ morphogenesis; negative regulation of transcription from RNA polymerase II promoter; cell differentiation

Research Articles on ETV7

Similar Products

Product Notes

The ETV7 etv7 (Catalog #AAA6377746) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ETV7 (Transcription Factor ETV7, ETS Translocation Variant 7, ETS-related Protein Tel2, Tel-related Ets Factor, Transcription Factor Tel-2, TEL2, TELB, TREF) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ETV7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ETV7 etv7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ETV7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.