Hemopexin Recombinant Protein | HPX recombinant protein

Human CellExp Hemopexin, Human Recombinant

Cat. Num. AAA849837

• Gene Names: HPX; HX
• Purity: >95% by SDS-PAGE
• Synonyms: Hemopexin; Human CellExp Hemopexin; Human Recombinant; Beta-1B-glycoprotein; HPX; Hpxn; HPX recombinant protein

• Host: Human cells
• Purity/Purification: >95% by SDS-PAGE
• Form/Format: Liquid. Supplied as a 0.2 um filtered solution of 20mM MES, 150mM NaCl, and pH5.5
• Sequence: TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTHHHHHHH

• Gene Source: Human
• Endotoxin: <1.0 EU per/ug
• Preparation and Storage: Store at -20 degree C; Centrifuge the vial prior to opening.; Shelf life: ~12 months

SDS-Page

Related Product Information for HPX recombinant protein

Hemopexin (HPX) is plasma glycoprotein belongs to the family of the acute-phase proteins whose synthesis is induced after an inflammatory event. Hemopexin with two four-bladed beta -propeller folds has been found in other proteins including collagenases and provides sites for protein-protein interactions. The liver is the major synthesizing organ. Hemopexin participates in maintaining and recycling the iron pool by utilizing its high binding affinity toward heme composed of protoporphyrin IX and iron. It also functions in preventing oxidation caused by heme after hemolysis. Hydrophobic heme molecules can intercalate into lipid membranes and participate in the oxidation of lipid membrane components through the Fenton reaction resulting in lipid peroxidation. Hemopexin undergoes a conformational change upon the binding of heme. The conformational change allows hemopexin to interact with a specific receptor, forming a complex which is then internalized. Heme concentrations in plasma increase after hemolysis, which is associated with several pathological conditions such as reperfusion injury and ischemia.

Product Categories/Family for HPX recombinant protein

Proteins; Enzymes; Proteins & Enzymes (A-Z); Other Proteins & Enzymes; Cell Damage & Oxidative Stress; Human cell expressed recombinant proteins

NCBI and Uniprot Product Information

• NCBI GI #: 11321561
• NCBI GeneID: 3263
• NCBI Accession #: NP_000604.1
• NCBI GenBank Nucleotide #: NM_000613.2
• UniProt Accession #: P02790; B2R957
• Molecular Weight: 51,676 Da
• NCBI Official Full Name: hemopexin
• NCBI Official Synonym Full Names: hemopexin
• NCBI Official Symbol: HPX
• NCBI Official Synonym Symbols: HX
• NCBI Protein Information: hemopexin; beta-1B-glycoprotein
• UniProt Protein Name: Hemopexin
• Protein Family: Hemopexin
• UniProt Gene Name: HPX
• UniProt Entry Name: HEMO_HUMAN

NCBI Description

This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq, Apr 2009]

Uniprot Description

HPX: Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation. Belongs to the hemopexin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p15.5-p15.4

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; metal ion binding; heme transporter activity

Biological Process: positive regulation of humoral immune response mediated by circulating immunoglobulin; receptor-mediated endocytosis; positive regulation of immunoglobulin production; heme transport; positive regulation of tyrosine phosphorylation of Stat1 protein; viral reproduction; hemoglobin metabolic process; cellular iron ion homeostasis; heme metabolic process