UPF0609 protein C4orf27 homolog Recombinant Protein | Hpf1 recombinant protein
Recombinant Mouse UPF0609 protein C4orf27 homolog
Gene Names
Hpf1; C4orf27; 2700029M09Rik; C230006B22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
UPF0609 protein C4orf27 homolog; Recombinant Mouse UPF0609 protein C4orf27 homolog; Hpf1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-346, full length protein
Sequence
MVGGGGKRRTAGAGPQCEKTVEVKKSKFSEADVSSDLRKEVENLYKLSLPEDFYHFWKFCEELDPEKPADALATSLGLRLVGPYDILAGKHKMKKKPTGLNCNLHWRFYYDPPEFQTIIIGDNKTQYHMGYFRDSPDELPVYVGTNEAKKNCIIIQNGDNVFAAIKLFLMKKLKEVTDRKKISILKNIDEKLTEAARKLGYSLEQRTVKMRQRDKKVVTKTFHGAGLVVPVDKNDVGYRELPETDADLKRICKAVVDAASDEERLKAFAPIQEMMTFVQFANDECDYGMGLELGMDLFCYGSHYFHKVAGQLLPLAYNLLKRDLFAKIIEDHLASRSEENIDQLAG
Sequence Length
346
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,291 Da
NCBI Official Full Name
histone PARylation factor 1 isoform 1
NCBI Official Synonym Full Names
histone PARylation factor 1
NCBI Official Symbol
Hpf1
NCBI Official Synonym Symbols
C4orf27; 2700029M09Rik; C230006B22Rik
NCBI Protein Information
histone PARylation factor 1; UPF0609 protein C4orf27 homolog
UniProt Protein Name
Histone PARylation factor 1
Protein Family
UniProt Gene Name
Hpf1
Uniprot Description
Acts as a cofactor for serine ADP-ribosylation by conferring serine specificity on PARP1 and PARP2: interacts with PARP1 and PARP1 and is able to change amino acid specificity toward serine. Promotes histone serine ADP-ribosylation in response to DNA damage, limiting DNA damage-induced PARP1 hyper-automodification, and ensuring genome stability.
Similar Products
Product Notes
The Hpf1 hpf1 (Catalog #AAA1306168) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-346, full length protein. The amino acid sequence is listed below: MVGGGGKRRT AGAGPQCEKT VEVKKSKFSE ADVSSDLRKE VENLYKLSLP EDFYHFWKFC EELDPEKPAD ALATSLGLRL VGPYDILAGK HKMKKKPTGL NCNLHWRFYY DPPEFQTIII GDNKTQYHMG YFRDSPDELP VYVGTNEAKK NCIIIQNGDN VFAAIKLFLM KKLKEVTDRK KISILKNIDE KLTEAARKLG YSLEQRTVKM RQRDKKVVTK TFHGAGLVVP VDKNDVGYRE LPETDADLKR ICKAVVDAAS DEERLKAFAP IQEMMTFVQF ANDECDYGMG LELGMDLFCY GSHYFHKVAG QLLPLAYNLL KRDLFAKIIE DHLASRSEEN IDQLAG. It is sometimes possible for the material contained within the vial of "UPF0609 protein C4orf27 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
