Mouse GNAQ Monoclonal Antibody | anti-GNAQ antibody

GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha, Guanine Nucleotide-binding Protein alpha-q, GAQ) (FITC)

Cat. Num. AAA6147418

• Gene Names: GNAQ; GAQ; SWS; CMC1; G-ALPHA-q
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GNAQ; Monoclonal Antibody; GNAQ (Guanine Nucleotide-binding Protein G(q) Subunit alpha; Guanine Nucleotide-binding Protein alpha-q; GAQ) (FITC); anti-GNAQ antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3B9
• Specificity: Recognizes human GNAQ. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GNAQ antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa101-200 from human GNAQ (NP_002063) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: YKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVI
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged GNAQ is 1ng/ml as a capture antibody.)

Related Product Information for anti-GNAQ antibody

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro).

Product Categories/Family for anti-GNAQ antibody

Antibodies; G Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 40254462
• NCBI GeneID: 2776
• NCBI Accession #: NP_002063.2
• NCBI GenBank Nucleotide #: NM_002072
• UniProt Accession #: P50148; O15108; Q13462; Q6NT27; Q92471; Q9BZB9
• Molecular Weight: 42,142 Da
• NCBI Official Full Name: guanine nucleotide-binding protein G(q) subunit alpha
• NCBI Official Synonym Full Names: G protein subunit alpha q
• NCBI Official Symbol: GNAQ
• NCBI Official Synonym Symbols: GAQ; SWS; CMC1; G-ALPHA-q
• NCBI Protein Information: guanine nucleotide-binding protein G(q) subunit alpha
• UniProt Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha
• UniProt Gene Name: GNAQ
• UniProt Synonym Gene Names: GAQ
• UniProt Entry Name: GNAQ_HUMAN

Uniprot Description

G-alpha(q): a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Agonist binding to Gq-coupled receptors may block Akt activation via the release of active G-alpha(q) subunits that inhibit phosphatidylinositol 3-kinase. Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.

Protein type: G protein; G protein, heterotrimeric; G protein, heterotrimeric alpha G(q)

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: cytoplasm; lysosomal membrane; photoreceptor outer segment; plasma membrane

Molecular Function: GTPase activator activity; GTPase activity; protein binding; type 2A serotonin receptor binding

Biological Process: acetylcholine receptor signaling, muscarinic pathway; blood coagulation; dopamine receptor, phospholipase C activating pathway; entrainment of circadian clock; G-protein signaling, adenylate cyclase activating pathway; glutamate signaling pathway; negative regulation of protein kinase activity; phospholipase C activation; phototransduction, visible light; platelet activation; protein stabilization; regulation of action potential

Disease: Capillary Malformations, Congenital; Sturge-weber Syndrome