Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE (SDS-PAGE: purified HA (H7N9)(A/Wuxi/2/2009)(aa19-535) protein)

HA (H7N9) (A/Wuxi/2/2013) Recombinant Protein | HA recombinant protein

HA (H7N9)(aa 19-535) (A/Wuxi/2/2013)

Applications
ELISA
Purity
> = 95% (SDS-PAGE)
Synonyms
HA (H7N9) (A/Wuxi/2/2013); HA (H7N9)(aa 19-535) (A/Wuxi/2/2013); HA (A/Wuxi/2/2013)(aa 19-535); ha (h7n9) (aa19-524) (a/wuxi/22013); HA recombinant protein
Ordering
For Research Use Only!
Host
293 cell culture
Purity/Purification
> = 95% (SDS-PAGE)
Concentration
1 ug/ul in PBS (varies by lot)
Sequence
DKICLGHHAVSNGTKVNTLTERGVEVVNATETVERTNIPRICSKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLIIERRE GSDVCYPGKFVNEEALRQILRESGGIDKEAMGFTYSGIRTNGSTSACRRSGSSFYAEMKWLLSNTDNAAFPQMTKSYKNTRK SPALIVWGIHHSVSTAEQTKLYGSGSKLVTVGSSNYQQSFVPSPGARPQVNGLSGRIDFHWLMLNPNDTVTFSFNGAFIAPD RASFLRGKSMGIQSGVQVDANCEGDCYHSGGTIISNLPFQNIDSRAVGKCPRYVKQRSLLLATGMKNVPEIPKGRGLFGAIA GFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLNRLIEKTNQQFELIDNEFNEVEKQIGNVINWTRDSIT EVWSYNAELLVAMENQHTIDLADSEMDKLYERVKRQLRENAEEDGTGCFEIFHKCDDDCMASIRNNTYDHSKYREEAMQNRI QIDPVKLSSGYKDV
Sequence Length
560
Applicable Applications for HA recombinant protein
Western blot standard, antibody ELISA, antigen, etc.
Endotoxin Level
<0.01 EU per 1 ug of the protein by LAL test
Viral Protein
C-terminal 6xHis tagged hemagglutinin (H7N9)(A/Wuxi/2/2013) protein (amino acid 19-535)(Genebank accession# AGN69462.1)
Preparation and Storage
Store at -20 degree C. Stable for 3-months from the date of shipment when kept at 4 degree C. Non-hazardous. No MSDS required.

SDS-PAGE

(SDS-PAGE: purified HA (H7N9)(A/Wuxi/2/2009)(aa19-535) protein)

SDS-PAGE (SDS-PAGE: purified HA (H7N9)(A/Wuxi/2/2009)(aa19-535) protein)
Related Product Information for HA recombinant protein
Description: Viral recombinant protein purified from 293 cell culture
Introduction: Influenza hemagglutinin (HA) is a type of hemagglutinin found on the surface of the influenza viruses. HA is an antigenic glycoprotein, like all other hemagglutinins, it causes red blood cells to agglutinate. HA is responsible for binding the virus to the cell that is being infected. HA proteins bind to cells with sialic acid on the membranes, such as cells in the upper respiratory tract or erythrocytes.
HA is a homotrimeric integral membrane glycoprotein. HA monomer is synthesized as a single polypeptide that is subsequently cleaved into two smaller polypeptides, the HA1 and HA2 subunits. Each HA monomer consists of a long, helical chain anchored in the membrane by HA2 and topped by a large HA1 globule.
H7N9 is a serotype of the species Influenza virus A (avian influenza virus or bird flu virus). Avian influenza A H7 viruses normally circulate amongst avian populations, but recently new H7N9 variants was first reported to have infected humans in 2013 in China. It is believed that certain mutations might have caused person to person H7N9 transmission.
Product Categories/Family for HA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
hemagglutinin
UniProt Protein Name
Hemagglutinin
Protein Family
UniProt Gene Name
HA
UniProt Entry Name
S4UZS9_9INFA

Uniprot Description

Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization of about two third of the virus particles through clathrin-dependent endocytosis and about one third through a clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.

Similar Products

Product Notes

The HA ha (Catalog #AAA434212) is a Recombinant Protein produced from 293 cell culture and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HA (H7N9) (A/Wuxi/2/2013) can be used in a range of immunoassay formats including, but not limited to, Western blot standard, antibody ELISA, antigen, etc. Researchers should empirically determine the suitability of the HA ha for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DKICLGHHAV SNGTKVNTLT ERGVEVVNAT ETVERTNIPR ICSKGKRTVD LGQCGLLGTI TGPPQCDQFL EFSADLIIER RE GSDVCY PGKFVNEEAL RQILRESGGI DKEAMGFTYS GIRTNGSTSA CRRSGSSFYA EMKWLLSNTD NAAFPQMTKS YKNTRK SP ALIVWGIHHS VSTAEQTKLY GSGSKLVTVG SSNYQQSFVP SPGARPQVNG LSGRIDFHWL MLNPNDTVTF SFNGAFIAPD RASFLRGK SMGIQSGVQV DANCEGDCYH SGGTIISNLP FQNIDSRAVG KCPRYVKQRS LLLATGMKNV PEIPKGRGLF GAIA GFIE NGWEGLIDGW YGFRHQNAQG EGTAADYKST QSAIDQITGK LNRLIEKTNQ QFELIDNEFN EVEKQIGNVI NWTRDSIT EVWSYNAELL VAMENQHTID LADSEMDKLY ERVKRQLREN AEEDGTGCFE IFHKCDDDCM ASIRNNTYDH SKYREEAMQN RI QIDPVK LSSGYKDV. It is sometimes possible for the material contained within the vial of "HA (H7N9) (A/Wuxi/2/2013), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.