Mouse anti-Human QDPR Monoclonal Antibody | anti-QDPR antibody

QDPR (Quinoid Dihydropteridine Reductase, HDHPR, Dihydropteridine Reductase, DHPR, FLJ42391) (AP)

Cat. Num. AAA6133243

• Gene Names: QDPR; DHPR; PKU2; SDR33C1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: QDPR; Monoclonal Antibody; QDPR (Quinoid Dihydropteridine Reductase; HDHPR; Dihydropteridine Reductase; DHPR; FLJ42391) (AP); anti-QDPR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: M1
• Specificity: Recognizes human QDPR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-QDPR antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to human QDPR, aa1-245 (AAH00576) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(QDPR monoclonal antibody, Western Blot analysis of QDPR expression in HL-60.)

Western Blot (WB)

(Western Blot analysis of QDPR expression in transfected 293T cell line by QDPR monoclonal antibody Lane 1: QDPR transfected lysate (25.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged QDPR is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of QDPR over-expressed 293 cell line, cotransfected with QDPR Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with QDPR monoclonal antibody (M02). GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-QDPR antibody

QDPR is the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems.

Product Categories/Family for anti-QDPR antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 34783046
• NCBI GeneID: 5860
• Molecular Weight: 22,408 Da
• NCBI Official Full Name: Homo sapiens quinoid dihydropteridine reductase, mRNA
• NCBI Official Synonym Full Names: quinoid dihydropteridine reductase
• NCBI Official Symbol: QDPR
• NCBI Official Synonym Symbols: DHPR; PKU2; SDR33C1
• NCBI Protein Information: dihydropteridine reductase
• Protein Family: Dihydropteridine reductase

NCBI Description

This gene encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations. Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase. [provided by RefSeq, Jul 2008]