Guanylyl cyclase-activating protein 2 (GUCA1B) Recombinant Protein | GUCA1B recombinant protein
Recombinant Human Guanylyl cyclase-activating protein 2 (GUCA1B)
Gene Names
GUCA1B; RP48; GCAP2; GUCA2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanylyl cyclase-activating protein 2 (GUCA1B); Recombinant Human Guanylyl cyclase-activating protein 2 (GUCA1B); GUCA1B recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-200, Full length protein
Sequence
GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
Sequence Length
199
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for GUCA1B recombinant protein
This protein is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,420 Da
NCBI Official Full Name
guanylyl cyclase-activating protein 2
NCBI Official Synonym Full Names
guanylate cyclase activator 1B
NCBI Official Symbol
GUCA1B
NCBI Official Synonym Symbols
RP48; GCAP2; GUCA2
NCBI Protein Information
guanylyl cyclase-activating protein 2
UniProt Protein Name
Guanylyl cyclase-activating protein 2
Protein Family
UniProt Gene Name
GUCA1B
UniProt Synonym Gene Names
GCAP2; GCAP 2
NCBI Description
The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009]
Uniprot Description
Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low, and GC1 and GC2 when free calcium ions concentration is elevated. This Ca2+-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure.MiscellaneousBinds three calcium ions.
Research Articles on GUCA1B
Similar Products
Product Notes
The GUCA1B guca1b (Catalog #AAA1407365) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-200, Full length protein. The amino acid sequence is listed below: GQEFSWEEAE AAGEIDVAEL QEWYKKFVME CPSGTLFMHE FKRFFKVTDD EEASQYVEGM FRAFDKNGDN TIDFLEYVAA LNLVLRGTLE HKLKWTFKIY DKDGNGCIDR LELLNIVEGI YQLKKACRRE LQTEQGQLLT PEEVVDRIFL LVDENGDGQL SLNEFVEGAR RDKWVMKMLQ MDMNPSSWLA QQRRKSAMF. It is sometimes possible for the material contained within the vial of "Guanylyl cyclase-activating protein 2 (GUCA1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
