Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-2 (Gnb2) Recombinant Protein | Gnb2 recombinant protein

Recombinant Mouse Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-2 (Gnb2)

Cat. Num. AAA952652

• Gene Names: Gnb2; Gnb-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-2 (Gnb2); Recombinant Mouse Guanine nucleotide-binding protein G (I)/G (S)/G (T) subunit beta-2 (Gnb2); Gnb2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-340, Full length protein
• Sequence: SELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
• Sequence Length: 339

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Gnb2 recombinant protein

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5 UTR.

NCBI and Uniprot Product Information

• NCBI GI #: 13937391
• NCBI GeneID: 14693
• NCBI Accession #: NP_034442.1
• NCBI GenBank Nucleotide #: NM_010312.5
• UniProt Accession #: P62880; P11016; P54312
• Molecular Weight: 37,331 Da
• NCBI Official Full Name: guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• NCBI Official Synonym Full Names: guanine nucleotide binding protein (G protein), beta 2
• NCBI Official Symbol: Gnb2
• NCBI Official Synonym Symbols: Gnb-2
• NCBI Protein Information: guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• UniProt Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• UniProt Gene Name: Gnb2

Uniprot Description

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.