Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 Recombinant Protein | GNB2 recombinant protein

Recombinant Human Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

Cat. Num. AAA717351

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; Recombinant Human Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; G protein subunit beta-2; Transducin beta chain 2; GNB2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 21-327aa; Partial
• Sequence: ARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAV
• Sequence Length: 340

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GNB2 recombinant protein

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacent of GDP by GTP, and for G protein-effector interaction.

Product Categories/Family for GNB2 recombinant protein

Metabolism

References

Distinct forms of the beta subunit of GTP-binding regulatory proteins identified by molecular cloning.Fong H.K.W., Amatruda T.T. III, Birren B.W., Simon M.I.Proc. Natl. Acad. Sci. U.S.A. 84:3792-3796(1987) A second form of the beta subunit of signal-transducing G proteins.Gao B., Gilman A.G., Robishaw J.D.Proc. Natl. Acad. Sci. U.S.A. 84:6122-6125(1987) Large-scale sequencing of two regions in human chromosome 7q22 analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.Gloeckner G., Scherer S., Schattevoy R., Boright A.P., Weber J., Tsui L.-C., Rosenthal A.Genome Res. 8:1060-1073(1998) cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org) .Puhl H.L. III, Ikeda S.R., Aronstam R.S.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) Bienvenut W.V.Submitted (JUL-2005) to UniProtKB G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1 regulation of cell shape and reactive oxygen species production.Niu J., Profirovic J., Pan H., Vaiskunaite R., Voyno-Yasenetskaya T.Circ. Res. 93:848-856(2003) Ataxin 10 induces neuritogenesis via interaction with G-protein beta2 subunit.Waragai M., Nagamitsu S., Xu W., Li Y.J., Lin X., Ashizawa T.J. Neurosci. Res. 83:1170-1178(2006) Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.Anal. Chem. 81:4493-4501(2009) The cationic region of Rhes mediates its interactions with specific Gbeta subunits.Hill C., Goddard A., Ladds G., Davey J.Cell. Physiol. Biochem. 23:1-8(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 20357529
• NCBI GeneID: 2783
• NCBI Accession #: NP_005264.2
• NCBI GenBank Nucleotide #: NM_005273.3
• UniProt Accession #: P62879; P11016; P54312; B3KPU1
• Molecular Weight: 60.4 kDa
• NCBI Official Full Name: guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• NCBI Official Synonym Full Names: guanine nucleotide binding protein (G protein), beta polypeptide 2
• NCBI Official Symbol: GNB2
• NCBI Protein Information: guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• UniProt Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
• UniProt Gene Name: GNB2
• UniProt Entry Name: GBB2_HUMAN

NCBI Description

Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. [provided by RefSeq, Jul 2008]

Uniprot Description

G-beta 2: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Belongs to the WD repeat G protein beta family.

Protein type: G protein, heterotrimeric beta; G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 7q22

Cellular Component: extracellular space; focal adhesion; lysosomal membrane; membrane; myelin sheath; perinuclear region of cytoplasm; plasma membrane; protein complex; vesicle

Molecular Function: calcium channel regulator activity; GTPase activity; GTPase binding; protein binding; protein complex binding; signal transducer activity

Biological Process: energy reserve metabolic process; G-protein coupled receptor protein signaling pathway; synaptic transmission