SDS-Page
Guanine nucleotide-binding protein G (t) subunit alpha-2 (GNAT2) Recombinant Protein | GNAT2 recombinant protein
Recombinant Bovine Guanine nucleotide-binding protein G (t) subunit alpha-2 (GNAT2)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Guanine nucleotide-binding protein G (t) subunit alpha-2 (GNAT2); Recombinant Bovine Guanine nucleotide-binding protein G (t) subunit alpha-2 (GNAT2); GNAT2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-354aa; Full Length of Mature Protein
Sequence
GSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEYKAIIYGNVLQSILAIIRAMPTLGIDYAEVSCVDNGRQLNNLADSIEEGTMPPELVEVIRKLWKDGGVQACFDRAAEYQLNDSASYYLNQLDRITAPDYLPNEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYEDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Species
Bos taurus (Bovine)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for GNAT2 recombinant protein
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.
Product Categories/Family for GNAT2 recombinant protein
References
"Sequence of the alpha subunit of photoreceptor G protein: homologies between transducin, ras, and elongation factors." Lochrie M.A., Hurley J.B., Simon M.I. Science 228:96-99(1985)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44.0 kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(t) subunit alpha-2
NCBI Official Synonym Full Names
G protein subunit alpha transducin 2
NCBI Official Symbol
GNAT2
NCBI Protein Information
guanine nucleotide-binding protein G(t) subunit alpha-2
UniProt Protein Name
Guanine nucleotide-binding protein G(t) subunit alpha-2
UniProt Gene Name
GNAT2
Uniprot Description
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase.
Similar Products
Product Notes
The GNAT2 gnat2 (Catalog #AAA718903) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-354aa; Full Length of Mature Protein. The amino acid sequence is listed below: GSGASAEDKE LAKRSKELEK KLQEDADKEA KTVKLLLLGA GESGKSTIVK QMKIIHQDGY SPEECLEYKA IIYGNVLQSI LAIIRAMPTL GIDYAEVSCV DNGRQLNNLA DSIEEGTMPP ELVEVIRKLW KDGGVQACFD RAAEYQLNDS ASYYLNQLDR ITAPDYLPNE QDVLRSRVKT TGIIETKFSV KDLNFRMFDV GGQRSERKKW IHCFEGVTCI IFCAALSAYD MVLVEDDEVN RMHESLHLFN SICNHKFFAA TSIVLFLNKK DLFEEKIKKV HLSICFPEYD GNNSYEDAGN YIKSQFLDLN MRKDVKEIYS HMTCATDTQN VKFVFDAVTD IIIKENLKDC GLF . It is sometimes possible for the material contained within the vial of "Guanine nucleotide-binding protein G (t) subunit alpha-2 (GNAT2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
