Glycoprotein (G) Recombinant Protein | G recombinant protein

Recombinant Rabies virus Glycoprotein (G), partial

Cat. Num. AAA1265619

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glycoprotein (G); Recombinant Rabies virus Glycoprotein (G); partial; G recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-459 aa; partial
• Sequence: KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for G recombinant protein

Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.

References

Structure of the glycoprotein gene in rabies virus.Anilionis A., Wunner W.H., Curtis P.J.Nature 294:275-278(1981) Amino acid sequence of the rabies virus glycoprotein deduced from its cloned gene.Anilionis A., Wunner W.H., Curtis P.J.Comp. Immunol. Microbiol. Infect. Dis. 5:27-32(1982) Complete nucleotide sequencing of SAD derivatives of attenuated rabies virus vaccine strains.Geue L., Schares S., Schnick C., Kliemt J., Beckert A., Hoffmann B., Freuling C., Marston D., McElhinney L., Fooks A., Zanoni R., Peterhans E., Cox J.H., Mueller T. Antigenic variants of CVS rabies virus with altered glycosylation sites.Wunner W.H., Dietzschold B., Smith C.L., Lafon M., Golub E.Virology 140:1-12(1985) N-linked glycosylation of rabies virus glycoprotein. Individual sequons differ in their glycosylation efficiencies and influence on cell surface expression.Shakin-Eshleman S.H., Remaley A.T., Eshleman J.R., Wunner W.H., Spitalnik S.L.J. Biol. Chem. 267:10690-10698(1992) The role of site-specific N-glycosylation in secretion of soluble forms of rabies virus glycoprotein.Wojczyk B.S., Stwora-Wojczyk M., Shakin-Eshleman S.H., Wunner W.H., Spitalnik S.L.Glycobiology 8:121-130(1998) Rabies virus receptors.Lafon M.J. Neurovirol. 11:82-87(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 138301
• UniProt Accession #: P03524; A3F5L8
• Molecular Weight: 50.6
• NCBI Official Full Name: Glycoprotein
• UniProt Protein Name: Glycoprotein
• UniProt Gene Name: G
• UniProt Entry Name: GLYCO_RABVE

Uniprot Description

Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.