Recoverin Recombinant Protein | RCVRN recombinant protein

Recombinant Human Recoverin

Cat. Num. AAA965646

• Gene Names: RCVRN; RCV1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Recoverin; Recombinant Human Recoverin; Cancer-associated retinopathy protein; Protein CAR; RCVRN recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-200aa; Full Length of Mature Protein
• Sequence: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

• Production Note: Special Offer: The Baculovirus, E Coli, Mammalian-Cell, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Baculovirus, E Coli, Mammalian-Cell, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Baculovirus, E Coli, Mammalian-Cell, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Baculovirus, E Coli, Mammalian-Cell, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for RCVRN recombinant protein

Ses to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse.

Product Categories/Family for RCVRN recombinant protein

Neuroscience

References

Isolation of human retinal genes recoverin cDNA and gene.Murakami A., Yajima T., Inana G.Biochem. Biophys. Res. Commun. 187:234-244(1992) Molecular cloning and nucleotide sequence of a cDNA encoding recoverin from human retina.Wiechmann A.F., Hammarback J.A.Exp. Eye Res. 56:463-470(1993) The cancer-associated retinopathy antigen is a recoverin-like protein.Thirkill C.E., Tait R.C., Tyler N.K., Roth A.M., Keltner J.L.Invest. Ophthalmol. Vis. Sci. 33:2768-2772(1992) Expression of a photoreceptor protein, recoverin, as a cancer-associated retinopathy autoantigen in human lung cancer cell lines.Matsubara S., Yamaji Y., Sato M., Fujita J., Takahara J.Br. J. Cancer 74:1419-1422(1996) Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.Oshikawa M., Tsutsui C., Ikegami T., Fuchida Y., Matsubara M., Toyama S., Usami R., Ohtoko K., Kato S.Invest. Ophthalmol. Vis. Sci. 52:6662-6670(2011) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. A photoreceptor calcium binding protein is recognized by autoantibodies obtained from patients with cancer-associated retinopathy.Polans A.S., Buczylko J., Crabb J., Palczewski K.J. Cell Biol. 112:981-989(1991) Crystal structure of human recoverin at 2.2 A resolution.RIKEN structural genomics initiative (RSGI) Submitted (FEB-2007) to the PDB data bank

NCBI and Uniprot Product Information

• NCBI GI #: 4506459
• NCBI GeneID: 5957
• NCBI Accession #: NP_002894.1
• NCBI GenBank Nucleotide #: NM_002903.2
• UniProt Accession #: P35243; Q53XL0
• Molecular Weight: 25 kDa
• NCBI Official Full Name: recoverin
• NCBI Official Synonym Full Names: recoverin
• NCBI Official Symbol: RCVRN
• NCBI Official Synonym Symbols: RCV1
• NCBI Protein Information: recoverin
• UniProt Protein Name: Recoverin
• Protein Family: Recoverin
• UniProt Gene Name: RCVRN
• UniProt Synonym Gene Names: RCV1; Protein CAR
• UniProt Entry Name: RECO_HUMAN

NCBI Description

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq, Jul 2008]

Uniprot Description

RCV1: Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse. Belongs to the recoverin family.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 17p13.1

Molecular Function: calcium ion binding; calcium sensitive guanylate cyclase activator activity

Biological Process: phototransduction, visible light; positive regulation of guanylate cyclase activity; regulation of calcium ion transport; regulation of rhodopsin mediated signaling; rhodopsin mediated signaling; signal transduction; visual perception