SDS-Page
(Recombinant Human GMF-beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)
GMF-beta Recombinant Protein | GMFB recombinant protein
Recombinant Human GMF-beta Protein
Gene Names
GMFB; GMF
Purity
>95% by SDS-PAGE.
Synonyms
GMF-beta; Recombinant Human GMF-beta Protein; GMF; GMFB recombinant protein
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Sequence Length
142
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human GMF-beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)
SDS-Page
(Recombinant Human GMF-beta Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)
Related Product Information for GMFB recombinant protein
Description: Recombinant Human GMF-beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser2-His142) of human GMF-beta (Accession #NP_004115.1).
Background: GMFB is a nerve growth factor which belongs to the actin-binding proteins ADF family, GMF subfamily.GMFB is involved in nervous system development, angiogenesis and immune function. It is especially crucial for the nervous system. GMFB causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. GMFB overexpression in astrocytes results in the increase of BDNF production.
Background: GMFB is a nerve growth factor which belongs to the actin-binding proteins ADF family, GMF subfamily.GMFB is involved in nervous system development, angiogenesis and immune function. It is especially crucial for the nervous system. GMFB causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. GMFB overexpression in astrocytes results in the increase of BDNF production.
Product Categories/Family for GMFB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
GMFB, partial
NCBI Official Synonym Full Names
glia maturation factor beta
NCBI Official Symbol
GMFB
NCBI Official Synonym Symbols
GMF
NCBI Protein Information
glia maturation factor beta
UniProt Protein Name
Glia maturation factor beta
Protein Family
UniProt Gene Name
GMFB
UniProt Synonym Gene Names
GMF-beta
UniProt Entry Name
GMFB_HUMAN
Uniprot Description
GMF-beta: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. Belongs to the actin-binding proteins ADF family. GMF subfamily.
Protein type: Actin-binding; Inhibitor; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 14q22.2
Cellular Component: intracellular
Molecular Function: signal transducer activity; growth factor activity; protein kinase inhibitor activity; enzyme activator activity; actin binding
Biological Process: positive regulation of catalytic activity; nervous system development; negative regulation of protein kinase activity; locomotory behavior; learning; signal transduction; protein amino acid phosphorylation
Research Articles on GMFB
Similar Products
Product Notes
The GMFB gmfb (Catalog #AAA9139634) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SESLVVCDVA EDLVEKLRKF RFRKETNNAA IIMKIDKDKR LVVLDEELEG ISPDELKDEL PERQPRFIVY SYKYQHDDGR VSYPLCFIFS SPVGCKPEQQ MMYAGSKNKL VQTAELTKVF EIRNTEDLTE EWLREKLGFF H. It is sometimes possible for the material contained within the vial of "GMF-beta, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
