Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Glutamate--tRNA ligase 1 Recombinant Protein | gltX1 recombinant protein

Recombinant Helicobacter pylori Glutamate--tRNA ligase 1

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate--tRNA ligase 1; Recombinant Helicobacter pylori Glutamate--tRNA ligase 1; Glutamyl-tRNA synthetase 1; gltX1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-463aa; Full Length
Sequence
MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYQDKEVFSMQELLELFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSVQELLKLLKPFSFSDLSHLNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFKLELNKANFNDESALENAMRQIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGKTESVKRIEDFLKN
Sequence Length
463
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for gltX1 recombinant protein
Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).
References
The complete genome sequence of the gastric pathogen Helicobacter pylori.Tomb J.-F., White O., Kerlavage A.R., Clayton R.A., Sutton G.G., Fleischmann R.D., Ketchum K.A., Klenk H.-P., Gill S.R., Dougherty B.A., Nelson K.E., Quackenbush J., Zhou L., Kirkness E.F., Peterson S.N., Loftus B.J., Richardson D.L., Dodson R.J., Khalak H.G., Glodek A., McKenney K., FitzGerald L.M., Lee N., Adams M.D., Hickey E.K., Berg D.E., Gocayne J.D., Utterback T.R., Peterson J.D., Kelley J.M., Cotton M.D., Weidman J.F., Fujii C., Bowman C., Watthey L., Wallin E., Hayes W.S., Borodovsky M., Karp P.D., Smith H.O., Fraser C.M., Venter J.C.Nature 388:539-547(1997) Akopyants N.S., Kersulyte D., Clifton S.W., Youree B.E., Reece C.A., Roe B.A., Berg D.E.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55.4 kDa
NCBI Official Full Name
glutamate--tRNA ligase
NCBI Official Symbol
gltX
NCBI Protein Information
glutamate--tRNA ligase
UniProt Protein Name
Glutamate--tRNA ligase 1
Protein Family
UniProt Gene Name
gltX1
UniProt Synonym Gene Names
GluRS 1
UniProt Entry Name
SYE1_HELPY

Uniprot Description

Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).

Similar Products

Product Notes

The gltX1 gltx1 (Catalog #AAA1023254) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-463aa; Full Length. The amino acid sequence is listed below: MSLIVTRFAP SPTGYLHIGG LRTAIFNYLF ARANQGKFFL RIEDTDLSRN SIEAANAIIE AFKWVGLEYD GEILYQSKRF EIYKEYIQKL LDEDKAYYCY MSKEELDALR EEQKARKETP RYDNRYRDFK GTPPKGIEPV VRIKVPQNEV IGFNDGVKGE VKVNTNELDD FIIARSDGTP TYNFVVTIDD ALMGITDVIR GDDHLSNTPK QIVLYKALNF KIPNFFHVPM ILNEEGQKLS KRHGATNVMD YQEMGYLKEA LVNFLARLGW SYQDKEVFSM QELLELFDPK DLNSSPSCFS WHKLNWLNAH YLKNQSVQEL LKLLKPFSFS DLSHLNPTQL DRLLDALKER SQTLKELALK IDEVLIAPVE YEEKVFKKLN QALVMPLLEK FKLELNKANF NDESALENAM RQIIEEEKIK AGSFMQPLRL ALLGKGGGIG LKEALFILGK TESVKRIEDF LKN. It is sometimes possible for the material contained within the vial of "Glutamate--tRNA ligase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.