Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glycine receptor subunit alpha-3 (GLRA3) Recombinant Protein | GLRA3 recombinant protein

Recombinant Human Glycine receptor subunit alpha-3 (GLRA3), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycine receptor subunit alpha-3 (GLRA3); Recombinant Human Glycine receptor subunit alpha-3 (GLRA3); partial; GLRA3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-252
Sequence
ARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQ
Sequence Length
464
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,963 Da
NCBI Official Full Name
glycine receptor subunit alpha-3 isoform b
NCBI Official Synonym Full Names
glycine receptor alpha 3
NCBI Official Symbol
GLRA3
NCBI Protein Information
glycine receptor subunit alpha-3
UniProt Protein Name
Glycine receptor subunit alpha-3
Protein Family
UniProt Gene Name
GLRA3

NCBI Description

This gene encodes a member of the ligand-gated ion channel protein family. The encoded protein is a member of the glycine receptor subfamily. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]

Uniprot Description

Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine (PubMed:9677400, PubMed:26416729). Channel characteristics depend on the subunit composition; heteropentameric channels display faster channel closure (). Plays an important role in the down-regulation of neuronal excitability (). Contributes to the generation of inhibitory postsynaptic currents (). Contributes to increased pain perception in response to increased prostaglandin E2 levels (). Plays a role in cellular responses to ethanol ().

Research Articles on GLRA3

Similar Products

Product Notes

The GLRA3 glra3 (Catalog #AAA1197239) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-252. The amino acid sequence is listed below: ARSRSAPMSP SDFLDKLMGR TSGYDARIRP NFKGPPVNVT CNIFINSFGS IAETTMDYRV NIFLRQKWND PRLAYSEYPD DSLDLDPSML DSIWKPDLFF ANEKGANFHE VTTDNKLLRI FKNGNVLYSI RLTLTLSCPM DLKNFPMDVQ TCIMQLESFG YTMNDLIFEW QDEAPVQVAE GLTLPQFLLK EEKDLRYCTK HYNTGKFTCI EVRFHLERQ. It is sometimes possible for the material contained within the vial of "Glycine receptor subunit alpha-3 (GLRA3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.