Glycine receptor subunit alpha-3 (GLRA3) Recombinant Protein | GLRA3 recombinant protein

Recombinant Human Glycine receptor subunit alpha-3 (GLRA3), partial

Cat. Num. AAA1197239

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Glycine receptor subunit alpha-3 (GLRA3); Recombinant Human Glycine receptor subunit alpha-3 (GLRA3); partial; GLRA3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 34-252
• Sequence: ARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQ
• Sequence Length: 464

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 110347433
• NCBI GeneID: 8001
• NCBI Accession #: NP_001036008.1
• NCBI GenBank Nucleotide #: NM_001042543.2
• UniProt Accession #: O75311; O75816; Q5D0E3; D3DP44
• Molecular Weight: 51,963 Da
• NCBI Official Full Name: glycine receptor subunit alpha-3 isoform b
• NCBI Official Synonym Full Names: glycine receptor alpha 3
• NCBI Official Symbol: GLRA3
• NCBI Protein Information: glycine receptor subunit alpha-3
• UniProt Protein Name: Glycine receptor subunit alpha-3
• Protein Family: Glycine receptor
• UniProt Gene Name: GLRA3

NCBI Description

This gene encodes a member of the ligand-gated ion channel protein family. The encoded protein is a member of the glycine receptor subfamily. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]

Uniprot Description

Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine (PubMed:9677400, PubMed:26416729). Channel characteristics depend on the subunit composition; heteropentameric channels display faster channel closure (). Plays an important role in the down-regulation of neuronal excitability (). Contributes to the generation of inhibitory postsynaptic currents (). Contributes to increased pain perception in response to increased prostaglandin E2 levels (). Plays a role in cellular responses to ethanol ().