Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Growth hormone receptor Recombinant Protein | GHR recombinant protein

Growth hormone receptor

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Growth hormone receptor; GHR recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
19-638aa; full length protein
Sequence
FSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFPWFLIIIFGIFGLTVMLFVFIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIQDSYKPEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNSHQKSLSVLAAKDDDSGRTSCYEPDILENDFNASDGCDGNSEVAQPQRLKGEADLLCLDQKNQNNSPYHDVSPAAQQPEVVLAEEDKPRPLLTGEIESTLQAAPSQLSNPNSLANIDFYAQVSDITPAGSVVLSPGQKNKAGNSQCDAHPEVVSLCQTNFIMDNAYFCEADAKKCIAVAPHVDVESRVEPSFNQEDIYITTESLTTTAERSGTAEDAPGSEMPVPDYTSIHLVQSPQGLVLNAATLPLPDKEFLSSCGYVSTDQLNKILP
Sequence Length
Full Length Protein
Species
Oryctolagus cuniculus (Rabbit)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for GHR recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for GHR recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,077 Da
NCBI Official Full Name
growth hormone receptor
NCBI Official Symbol
GHR
NCBI Protein Information
growth hormone receptor
UniProt Protein Name
Growth hormone receptor
Protein Family
UniProt Gene Name
GHR
UniProt Synonym Gene Names
GH receptor; GH-binding protein; GHBP
UniProt Entry Name
GHR_RABIT

Uniprot Description

GH receptor: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway. Defects in GHR are a cause of Laron syndrome (LARS). A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone. Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA). Short stature is defined by a subnormal rate of growth. Belongs to the type I cytokine receptor family. Type 1 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Research Articles on GHR

Similar Products

Product Notes

The GHR ghr (Catalog #AAA7042808) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-638aa; full length protein. The amino acid sequence is listed below: FSGSEATPAT LGRASESVQR VHPGLGTNSS GKPKFTKCRS PELETFSCHW TDGVHHGLKS PGSVQLFYIR RNTQEWTQEW KECPDYVSAG ENSCYFNSSY TSIWIPYCIK LTNNGGMVDQ KCFSVEEIVQ PDPPIGLNWT LLNVSLTGIH ADIQVRWEPP PNADVQKGWI VLEYELQYKE VNETQWKMMD PVLSTSVPVY SLRLDKEYEV RVRSRQRSSE KYGEFSEVLY VTLPQMSPFT CEEDFRFPWF LIIIFGIFGL TVMLFVFIFS KQQRIKMLIL PPVPVPKIKG IDPDLLKEGK LEEVNTILAI QDSYKPEFYN DDSWVEFIEL DIDDPDEKTE GSDTDRLLSN SHQKSLSVLA AKDDDSGRTS CYEPDILEND FNASDGCDGN SEVAQPQRLK GEADLLCLDQ KNQNNSPYHD VSPAAQQPEV VLAEEDKPRP LLTGEIESTL QAAPSQLSNP NSLANIDFYA QVSDITPAGS VVLSPGQKNK AGNSQCDAHP EVVSLCQTNF IMDNAYFCEA DAKKCIAVAP HVDVESRVEP SFNQEDIYIT TESLTTTAER SGTAEDAPGS EMPVPDYTSI HLVQSPQGLV LNAATLPLPD KEFLSSCGYV STDQLNKILP. It is sometimes possible for the material contained within the vial of "Growth hormone receptor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.