H/ACA ribonucleoprotein complex subunit 1 (GAR1) Recombinant Protein | GAR1 recombinant protein

Recombinant Human H/ACA ribonucleoprotein complex subunit 1 (GAR1)

Cat. Num. AAA1430723

• Gene Names: GAR1; NOLA1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: H/ACA ribonucleoprotein complex subunit 1 (GAR1); Recombinant Human H/ACA ribonucleoprotein complex subunit 1 (GAR1); GAR1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-217, Full length protein
• Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH
• Sequence Length: 217

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for GAR1 recombinant protein

This gene is a member of the H
ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C
D and H
ACA. The H
ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H
ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H
ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 9506713
• NCBI GeneID: 54433
• NCBI Accession #: NP_061856.1
• NCBI GenBank Nucleotide #: NM_018983.3
• UniProt Accession #: Q9NY12; Q5MJQ2
• Molecular Weight: 20,834 Da
• NCBI Official Full Name: H/ACA ribonucleoprotein complex subunit 1
• NCBI Official Synonym Full Names: GAR1 ribonucleoprotein
• NCBI Official Symbol: GAR1
• NCBI Official Synonym Symbols: NOLA1
• NCBI Protein Information: H/ACA ribonucleoprotein complex subunit 1
• UniProt Protein Name: H/ACA ribonucleoprotein complex subunit 1
• Protein Family: H/ACA ribonucleoprotein complex
• UniProt Gene Name: GAR1
• UniProt Synonym Gene Names: NOLA1

NCBI Description

This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA2 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. These four H/ACA snoRNP proteins are also components of the telomerase complex. The encoded protein of this gene contains two glycine- and arginine-rich domains and is related to Saccharomyces cerevisiae Gar1p. Two splice variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme.