Gamma-aminobutyric acid receptor-associated protein-like 2 Recombinant Protein | GABARAPL2 recombinant protein

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2

Cat. Num. AAA717179

• Gene Names: GABARAPL2; ATG8; GEF2; ATG8C; GEF-2; GATE16; GATE-16
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Gamma-aminobutyric acid receptor-associated protein-like 2; Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2; GABA(A) receptor-associated protein-like 2; Ganglioside expression factor 2; GEF-2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; GATE-16; MAP1 light chain 3-related protein; GABARAPL2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-117aa; Full Length
• Sequence: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
• Sequence Length: 117

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for GABARAPL2 recombinant protein

Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirents and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Product Categories/Family for GABARAPL2 recombinant protein

Transport

References

Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain possible role of vesicular transport in axonal elongation.Okazaki N., Yan J., Yuasa S., Ueno T., Kominami E., Masuho Y., Koga H., Muramatsu M.-A.Brain Res. Mol. Brain Res. 85:1-12(2000)

NCBI and Uniprot Product Information

• NCBI GI #: 6005768
• NCBI GeneID: 11345
• NCBI Accession #: NP_009216.1
• NCBI GenBank Nucleotide #: NM_007285.6
• UniProt Accession #: P60520; O08765; Q6FG91; Q9DCP8; Q9UQF7
• Molecular Weight: 40.7 kDa
• NCBI Official Full Name: gamma-aminobutyric acid receptor-associated protein-like 2
• NCBI Official Synonym Full Names: GABA(A) receptor-associated protein like 2
• NCBI Official Symbol: GABARAPL2
• NCBI Official Synonym Symbols: ATG8; GEF2; ATG8C; GEF-2; GATE16; GATE-16
• NCBI Protein Information: gamma-aminobutyric acid receptor-associated protein-like 2
• UniProt Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 2
• Protein Family: Gamma-aminobutyric acid receptor-associated protein
• UniProt Gene Name: GABARAPL2
• UniProt Synonym Gene Names: FLC3A; GEF2; GEF-2; GATE-16
• UniProt Entry Name: GBRL2_HUMAN

Uniprot Description

GABARAPL2: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. Implicated in intra-Golgi transport and post-mitotic Golgi re-assembly. Modulates the activity of SNAREs in the Golgi apparatus and is therefore an essential component of intra-Golgi transport and post-mitotic Golgi re-assembly. It first stimulates the ATPase activity of NSF, which in turn stimulates the association with GOSR1. Interacts with GABRG2, NSF, GOSR1 and beta-tubulin. Interacts with ULK1. Phosphorylated upon DNA damage, probably by ATM or ATR.

Protein type: Adaptor/scaffold; Autophagy; Microtubule-binding; Ubiquitin-like modifier; Vesicle

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: autophagic vacuole; cytoplasm; cytosol; Golgi apparatus; Golgi membrane; intracellular

Molecular Function: ATPase binding; beta-tubulin binding; GABA receptor binding; protein binding; SNARE binding; ubiquitin protein ligase binding

Biological Process: autophagic vacuole formation; cellular response to nitrogen starvation; intra-Golgi vesicle-mediated transport; macroautophagy; mitochondrion degradation; positive regulation of ATPase activity