SDS-PAGE
Gamma-aminobutyric acid receptor-associated protein-like 2 Recombinant Protein | GABARAPL2 recombinant protein
Recombinant human Gamma-aminobutyric acid receptor-associated protein-like 2
Gene Names
GABARAPL2; ATG8; GEF2; ATG8C; GEF-2; GATE16; GATE-16
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Gamma-aminobutyric acid receptor-associated protein-like 2; Recombinant human Gamma-aminobutyric acid receptor-associated protein-like 2; Recombinant human Gamma-aminobutyric acid receptor-associated protein-like 2 protein; GABARAPL2 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for GABARAPL2 recombinant protein
Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
References
[1] "Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation."
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40 KD
NCBI Official Full Name
Homo sapiens GABA(A) receptor-associated protein-like 2 (GABARAPL2), mRNA
NCBI Official Synonym Full Names
GABA(A) receptor-associated protein-like 2
NCBI Official Symbol
GABARAPL2
NCBI Official Synonym Symbols
ATG8; GEF2; ATG8C; GEF-2; GATE16; GATE-16
NCBI Protein Information
gamma-aminobutyric acid receptor-associated protein-like 2; ganglioside expression factor 2; MAP1 light chain 3 related protein; MAP1 light chain 3-related protein; general protein transport factor p16; golgi-associated ATPase enhancer of 16 kDa
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein-like 2
Protein Family
UniProt Gene Name
GABARAPL2
UniProt Synonym Gene Names
FLC3A; GEF2; GEF-2; GATE-16
UniProt Entry Name
GBRL2_HUMAN
Uniprot Description
Function: Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1
By similarity.
Subunit structure: Monomer. Interacts with GABRG2, NSF, GOSR1 and beta-tubulin
By similarity. Interacts with ULK1. Interacts with TP53INP1 and TP53INP2. Ref.1 Ref.8 Ref.11 Ref.12
Subcellular location: Golgi apparatus
By similarity. Cytoplasmic vesicle › autophagosome Ref.8.
Tissue specificity: Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine. Ref.1 Ref.2
Post-translational modification: Phosphorylated upon DNA damage, probably by ATM or ATR. Ref.6 Ref.7
Sequence similarities: Belongs to the MAP1 LC3 family.
Research Articles on GABARAPL2
Similar Products
Product Notes
The GABARAPL2 gabarapl2 (Catalog #AAA717165) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MKWMFKEDHS LEHRCVESAK IRAKYPDRVP VIVEKVSGSQ IVDIDKRKYL VPSDITVAQF MWIIRKRIQL PSEKAIFLFV DKTVPQSSLT MGQLYEKEKD EDGFLYVAYS GENTFGF. It is sometimes possible for the material contained within the vial of "Gamma-aminobutyric acid receptor-associated protein-like 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
