Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

L-fucose kinase (FUK) Recombinant Protein | FUK recombinant protein

Recombinant Human L-fucose kinase (FUK) , partial

Gene Names
FUK; 1110046B12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-fucose kinase (FUK); Recombinant Human L-fucose kinase (FUK); partial; FUK recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
834-1084; Partial, provide fragment at the C-terminal include the ATP Nucleotide binding region.
Sequence
LPHGSGLGTSSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRSRAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLLQDVLRSWYARLPAVVQNAHSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQKKLMAPGCEPLTVRRMMDVLAPHVHGQSLAGAGGGGFLYLLTKEPQQKEALEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTCCPFP
Sequence Length
1084
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FUK recombinant protein
This protein belongs to the GHMP (galacto-, homoserine, mevalonate and phosphomevalonate) kinase family and catalyzes the phosphorylation of L-fucose to form beta-L-fucose 1-phosphate. This enzyme catalyzes the first step in the utilization of free L-fucose in glycoprotein and glycolipid synthesis. L-fucose may be important in mediating a number of cell-cell interactions such as blood group antigen recognition, inflammation, and metastatis. While several transcript variants may exist for this gene, the full-length nature of only one has been described to date.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118,393 Da
NCBI Official Full Name
L-fucose kinase
NCBI Official Synonym Full Names
fucokinase
NCBI Official Symbol
FUK
NCBI Official Synonym Symbols
1110046B12Rik
NCBI Protein Information
L-fucose kinase
UniProt Protein Name
L-fucose kinase
Protein Family
UniProt Gene Name
FUK
UniProt Synonym Gene Names
Fucokinase

NCBI Description

The protein encoded by this gene belongs to the GHMP (galacto-, homoserine, mevalonate and phosphomevalonate) kinase family and catalyzes the phosphorylation of L-fucose to form beta-L-fucose 1-phosphate. This enzyme catalyzes the first step in the utilization of free L-fucose in glycoprotein and glycolipid synthesis. L-fucose may be important in mediating a number of cell-cell interactions such as blood group antigen recognition, inflammation, and metastatis. While several transcript variants may exist for this gene, the full-length nature of only one has been described to date. [provided by RefSeq, Jul 2008]

Uniprot Description

Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides.

Similar Products

Product Notes

The FUK fuk (Catalog #AAA1433941) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 834-1084; Partial, provide fragment at the C-terminal include the ATP Nucleotide binding region. The amino acid sequence is listed below: LPHGSGLGTS SILAGTALAA LQRAAGRVVG TEALIHAVLH LEQVLTTGGG WQDQVGGLMP GIKVGRSRAQ LPLKVEVEEV TVPEGFVQKL NDHLLLVYTG KTRLARNLLQ DVLRSWYARL PAVVQNAHSL VRQTEECAEG FRQGSLPLLG QCLTSYWEQK KLMAPGCEPL TVRRMMDVLA PHVHGQSLAG AGGGGFLYLL TKEPQQKEAL EAVLAKTEGL GNYSIHLVEV DTQGLSLKLL GTEASTCCPF P . It is sometimes possible for the material contained within the vial of "L-fucose kinase (FUK), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.