Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using FUK Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit anti-Human, Mouse FUK Polyclonal Antibody | anti-FUK antibody

FUK Rabbit pAb

Gene Names
FUK; 1110046B12Rik
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
FUK; Polyclonal Antibody; FUK Rabbit pAb; 1110046B12Rik; anti-FUK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LLKAAFICAGIVHVHSELQLSEQLLRTFGGGFELHTWSELPHGSGLGTSSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRSRAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLLQDVLRSWYARLPAVVQNAHSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQKKLMAPGCEPLTVRRMMDVLAPHVHGQSLAGAGGGGFLYLLTKEPQQKEALEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTCCPFP
Applicable Applications for anti-FUK antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 795-1084 of human FUK (NP_659496.2).
Positive Samples
U-87MG, Mouse brain, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using FUK Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using FUK Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-FUK antibody
Background: The protein encoded by this gene belongs to the GHMP (galacto-, homoserine, mevalonate and phosphomevalonate) kinase family and catalyzes the phosphorylation of L-fucose to form beta-L-fucose 1-phosphate. This enzyme catalyzes the first step in the utilization of free L-fucose in glycoprotein and glycolipid synthesis. L-fucose may be important in mediating a number of cell-cell interactions such as blood group antigen recognition, inflammation, and metastatis. While several transcript variants may exist for this gene, the full-length nature of only one has been described to date.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117,623 Da
NCBI Official Full Name
L-fucose kinase
NCBI Official Synonym Full Names
fucokinase
NCBI Official Symbol
FUK
NCBI Official Synonym Symbols
1110046B12Rik
NCBI Protein Information
L-fucose kinase
UniProt Protein Name
L-fucose kinase
Protein Family
UniProt Gene Name
FUK
UniProt Synonym Gene Names
Fucokinase
UniProt Entry Name
FUK_HUMAN

NCBI Description

The protein encoded by this gene belongs to the GHMP (galacto-, homoserine, mevalonate and phosphomevalonate) kinase family and catalyzes the phosphorylation of L-fucose to form beta-L-fucose 1-phosphate. This enzyme catalyzes the first step in the utilization of free L-fucose in glycoprotein and glycolipid synthesis. L-fucose may be important in mediating a number of cell-cell interactions such as blood group antigen recognition, inflammation, and metastatis. While several transcript variants may exist for this gene, the full-length nature of only one has been described to date. [provided by RefSeq, Jul 2008]

Uniprot Description

FUK: Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides. Belongs to the GHMP kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.52; Kinase, other; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: cytoplasm

Molecular Function: fucokinase activity; ATP binding

Biological Process: phosphorylation

Similar Products

Product Notes

The FUK fuk (Catalog #AAA9142690) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUK Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FUK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the FUK fuk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLKAAFICAG IVHVHSELQL SEQLLRTFGG GFELHTWSEL PHGSGLGTSS ILAGTALAAL QRAAGRVVGT EALIHAVLHL EQVLTTGGGW QDQVGGLMPG IKVGRSRAQL PLKVEVEEVT VPEGFVQKLN DHLLLVYTGK TRLARNLLQD VLRSWYARLP AVVQNAHSLV RQTEECAEGF RQGSLPLLGQ CLTSYWEQKK LMAPGCEPLT VRRMMDVLAP HVHGQSLAGA GGGGFLYLLT KEPQQKEALE AVLAKTEGLG NYSIHLVEVD TQGLSLKLLG TEASTCCPFP. It is sometimes possible for the material contained within the vial of "FUK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.