CD32 recombinant protein

CD32 (FcgammaRIIb) Recombinant Protein

Cat. Num. AAA3003587

• Gene Names: FCGR2B; CD32; FCG2; CD32B; FCGR2; IGFR2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD32; CD32 (FcgammaRIIb) Recombinant Protein; CD32 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 537
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD32 recombinant protein

Background: FcgammaRIIB (CD32B) is a low affinity, IgG Fc-binding receptor expressed on B cells, monocytes, macrophages, and dendritic cells (DCs). It is the inhibitory Fc receptor and signals through an immunoreceptor tyrosine-based inhibitory motif (ITIM) within its carboxy-terminal cytoplasmic tail. Binding of immune complexes to FcgammaRIIB results in tyrosine phosphorylation of the ITIM motif at Tyr292 and recruitment of the phosphatase SHIP, which mediates inhibitory effects on immune cell activation. In this way, FcgammaRIIB suppresses the effects of activating Fc-binding receptors. For example, mice deficient for FcgammaRIIB have greater T cell and DC responses following injection of immune complexes. In addition, FcgammaRIIB plays a role in B cell affinity maturation. Signaling through FcgammaRIIB in the absence of signaling through the B cell receptor (BCR) is proapoptotic, while signaling through FcgammaRIIB and the BCR simultaneously attenuates the apoptotic signal and results in selection of B cells with higher antigen affinity.

NCBI and Uniprot Product Information

• NCBI GI #: 50511932
• NCBI GeneID: 2213
• NCBI Accession #: NP_001002273.1
• NCBI GenBank Nucleotide #: NM_001002273.2
• UniProt Accession #: P31994; O95649; Q53X85; Q5VXA9; Q8NIA1; A6H8N3
• Molecular Weight: 34,044 Da
• NCBI Official Full Name: low affinity immunoglobulin gamma Fc region receptor II-b isoform 2
• NCBI Official Synonym Full Names: Fc fragment of IgG, low affinity IIb, receptor (CD32)
• NCBI Official Symbol: FCGR2B
• NCBI Official Synonym Symbols: CD32; FCG2; CD32B; FCGR2; IGFR2
• NCBI Protein Information: low affinity immunoglobulin gamma Fc region receptor II-b; CDw32; fcRII-b; Fc gamma RIIb; fc-gamma-RIIb; fc-gamma RII-b; igG Fc receptor II-b; Fc fragment of IgG, low affinity II, receptor for (CD32); Fc fragment of IgG, low affinity IIb, receptor for (CD
• UniProt Protein Name: Low affinity immunoglobulin gamma Fc region receptor II-b
• Protein Family: CD320 antigen
• UniProt Gene Name: FCGR2B
• UniProt Synonym Gene Names: CD32; FCG2; IGFR2; IgG Fc receptor II-b; Fc-gamma-RIIb; FcRII-b
• UniProt Entry Name: FCG2B_HUMAN

NCBI Description

The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in this gene may increase susceptibilty to systemic lupus erythematosus (SLE). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

FCGR2B: a transmembrane receptor for the Fc region of complexed or aggregated immunoglobulin gamma (IgG). Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down modulation of previous state of cell activation triggered via antigen receptors on B cells, T cells or via another Fc receptor. Three splice-variant isoforms have been observed.

Protein type: Membrane protein, integral; Cell surface; Oncoprotein

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; IgG binding

Biological Process: regulation of immune response; viral reproduction; immune response; signal transduction

Disease: Systemic Lupus Erythematosus; Malaria, Susceptibility To