Peroxiredoxin 4 Polyclonal Antibody | anti-PRDX4 antibody

Anti-Peroxiredoxin 4 Antibody

Cat. Num. AAA178056

• Gene Names: PRDX4; PRX-4; AOE372; AOE37-2; HEL-S-97n
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: Peroxiredoxin 4; Polyclonal Antibody; Anti-Peroxiredoxin 4 Antibody; Peroxiredoxin-4; Antioxidant enzyme 372; Antioxidant enzyme AOE372; AOE37 2; AOE37-2; AOE372; EC 1.11.1.15; Peroxiredoxin IV; Peroxiredoxin4; PRDX 4; PRDX4; PRDX4_HUMAN; PRX 4; Prx IV; Prx-IV; PRX4; PrxIV; Thioredoxin dependent peroxide reductase A0372; Thioredoxin Peroxidase (Antioxidant Enzyme); Thioredoxin peroxidase; Thioredoxin peroxidase AO372; Thioredoxin-dependent peroxide reductase A0372; TRANK antibody; peroxiredoxin 4; anti-PRDX4 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 271

• Applicable Applications for anti-PRDX4 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunocytochemistry (ICC)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml; Immunocytochemistry Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Peroxiredoxin 4 (178-2081aa SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK), different from the related mouse and rat sequences by one amino acid.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Peroxiredoxin 4 Picoband antibody, MBS178056, Western blottingAll lanes: Anti Peroxiredoxin 4 (MBS178056) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD)

Immunohistochemistry (IHC)

(Anti- Peroxiredoxin 4 Picoband antibody, MBS178056, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- Peroxiredoxin 4 Picoband antibody, MBS178056, IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC)

(Anti- Peroxiredoxin 4 Picoband antibody, MBS178056, IHC(P)IHC(P): Human Tonsil Tissue )

Immunocytochemistry (ICC)

(Anti- Peroxiredoxin 4 Picoband antibody, MBS178056, ICCICC: A549 Cell )

Related Product Information for anti-PRDX4 antibody

Description: Rabbit IgG polyclonal antibody for Peroxiredoxin-4(PRDX4) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.

Background: PRDX4 (peroxiredoxin 4) is also known as AOE37-2. The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. Functional analysis showed that PRDX4 protects glutamine synthetase from inactivation. Yeast 2-hybrid, immunoprecipitation, and immunoblot analyses indicated that PRDX4 and PRDX1 are capable of homodimerization and heterodimerization with each other but not with the mitochondrial PRDX3. Gel mobility shift and immunoblot analysis found that PRDX4 depletes NFKB binding activity together with a reduction in the amounts of p50, p65, and phosphorylated IKBA, as well as a reduction in the expression of HIV-1 viral proteins. Expression of PRDX4, alone or with PRDX1, increased the resistance of yeast cells to oxidant-induced toxicity. Jin et al. suggested PRDX4 modulates IKBA phosphorylation in the cytoplasm and thus affects a peroxiredoxin-dependent redox step.

References

1. Jin, D.-Y, Chae, H. Z, Rhee, S. G, Jeang, K.-T. Regulatory role for a novel human thioredoxin peroxidase in NF-kappa-B activation. J. Biol. Chem. 272: 30952-30961, 1997.

NCBI and Uniprot Product Information

• NCBI GI #: 5453549
• NCBI GeneID: 10549
• NCBI Accession #: NP_006397.1
• NCBI GenBank Nucleotide #: NM_006406.1
• UniProt Accession #: Q13162; Q6FHT3
• Molecular Weight: 30,540 Da
• NCBI Official Full Name: peroxiredoxin-4
• NCBI Official Synonym Full Names: peroxiredoxin 4
• NCBI Official Symbol: PRDX4
• NCBI Official Synonym Symbols: PRX-4; AOE372; AOE37-2; HEL-S-97n
• NCBI Protein Information: peroxiredoxin-4
• UniProt Protein Name: Peroxiredoxin-4
• Protein Family: Peroxiredoxin
• UniProt Gene Name: PRDX4
• UniProt Synonym Gene Names: AOE37-2; Prx-IV
• UniProt Entry Name: PRDX4_HUMAN

NCBI Description

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB. [provided by RefSeq, Jul 2008]

Uniprot Description

PRDX4: Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. Belongs to the AhpC/TSA family.

Protein type: Oxidoreductase; EC 1.11.1.15; Secreted; Secreted, signal peptide; Mitochondrial

Chromosomal Location of Human Ortholog: Xp22.11

Cellular Component: cytosol; extracellular space; mitochondrion; nucleus; smooth endoplasmic reticulum

Molecular Function: protein binding; protein homodimerization activity; thioredoxin peroxidase activity

Biological Process: 4-hydroxyproline metabolic process; cell redox homeostasis; extracellular matrix organization and biogenesis; I-kappaB phosphorylation; male gonad development; protein maturation via protein folding; spermatogenesis