FABP1/L-FABP Recombinant Protein | FABP1 recombinant protein

Recombinant Human FABP1/L-FABP Protein

Cat. Num. AAA9139934

• Gene Names: FABP1; FABPL; L-FABP
• Purity: >95% by SDS-PAGE.
• Synonyms: FABP1/L-FABP; Recombinant Human FABP1/L-FABP Protein; Fatty Acid-Binding Protein Liver; Fatty Acid-Binding Protein 1; Liver-Type Fatty Acid-BindingProtein; L-FABP; FABP1; FABPL; FABP1 recombinant protein

• Host: E Coli
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Sequence: MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
• Sequence Length: 127

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the N-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human FABP1/L-FABP Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Related Product Information for FABP1 recombinant protein

Description: Recombinant Human FABP1/L-FABP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ile127) of human FABP1/L-FABP (Accession #P07148) fused with a 6xHis tag at the N-terminus.

Background: Human Fatty Acid-Binding Protein 1 (FABP1) is a cytoplasm protein, which belongs to the calycin superfamilyand Fatty-acid binding protein (FABP) family. Fatty acid binding proteins are a family of small, highly conserved,cytoplasmic proteins that bind long-chain fatty acids. FABP1 forms a beta-barrel structure that accommodateshydrophobic ligands in its interior. FABP1 can bind free fatty acids and their coenzyme A derivatives, bilirubin,and some other small molecules in the cytoplasm, so it can be involved in intracellular lipid transport.

Product Categories/Family for FABP1 recombinant protein

Other Recombinant Protein

NCBI and Uniprot Product Information

• NCBI GI #: 182358
• NCBI GeneID: 2168
• UniProt Accession #: P07148
• NCBI Official Full Name: L-FABP
• NCBI Official Synonym Full Names: fatty acid binding protein 1
• NCBI Official Symbol: FABP1
• NCBI Official Synonym Symbols: FABPL; L-FABP
• NCBI Protein Information: fatty acid-binding protein, liver
• UniProt Protein Name: Fatty acid-binding protein, liver
• Protein Family: Fatty acid-binding protein
• UniProt Gene Name: FABP1
• UniProt Synonym Gene Names: FABPL; L-FABP
• UniProt Entry Name: FABPL_HUMAN

NCBI Description

This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]

Uniprot Description

Function: Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.

Subcellular location: Cytoplasm.

Domain: Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.

Sequence similarities: Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.