Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human FABP3/H-FABP Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

FABP3/H-FABP Recombinant Protein | FABP3 recombinant protein

Recombinant Human FABP3/H-FABP Protein

Gene Names
FABP3; MDGI; FABP11; H-FABP; M-FABP; O-FABP
Purity
>95% by SDS-PAGE.
Synonyms
FABP3/H-FABP; Recombinant Human FABP3/H-FABP Protein; Fatty Acid-Binding Protein Heart; Fatty Acid-Binding Protein 3; Heart-Type Fatty Acid-BindingProtein; H-FABP; Mammary-Derived Growth Inhibitor; MDGIMuscle Fatty Acid-Binding Protein; M-FABP; FABP3; FABP11; MDGI; FABP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 6.5.
Sequence
VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Sequence Length
133
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human FABP3/H-FABP Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human FABP3/H-FABP Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for FABP3 recombinant protein
Description: Recombinant Human FABP3/H-FABP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Ala133) of human FABP3/H-FABP (Accession #P05413) fused with an initial Met at the N-terminus and a 6xHis tag at the N-terminus.

Background: Fatty Acid Binding Protein 3 (FABP3) is a small cytoplasmic protein (15 kDa) that is released from cardiacmyocytes following an ischemic episode. Like the nine other distinct FABPs that have been identified, FABP3 isinvolved in active fatty acid metabolism where it transports fatty acids from the cell membrane tomitochondria for oxidation. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal-and cardiac-types. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellularmetabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cellgrowth and proliferation. The FABP3 gene contains four exons and its function is to arrest growth of mammaryepithelial cells. This gene is also a candidate tumor suppressor gene for human breast cancer. FABP3 is asensitive biomarker for myocardial infarction and can be detected in the blood within one to three hours ofonset of pain.
Product Categories/Family for FABP3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Fatty acid-binding protein, heart
NCBI Official Synonym Full Names
fatty acid binding protein 3
NCBI Official Symbol
FABP3
NCBI Official Synonym Symbols
MDGI; FABP11; H-FABP; M-FABP; O-FABP
NCBI Protein Information
fatty acid-binding protein, heart
UniProt Protein Name
Fatty acid-binding protein, heart
UniProt Gene Name
FABP3
UniProt Synonym Gene Names
FABP11; MDGI; H-FABP; MDGI; M-FABP
UniProt Entry Name
FABPH_HUMAN

NCBI Description

The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

FABP3: FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 1p33-p32

Cellular Component: extracellular space; sarcoplasm; cytosol

Molecular Function: protein binding; icosatetraenoic acid binding; cytoskeletal protein binding; long-chain fatty acid transporter activity

Biological Process: response to drug; negative regulation of cell proliferation; cholesterol homeostasis; regulation of fatty acid oxidation; fatty acid metabolic process; response to insulin stimulus; phospholipid homeostasis

Research Articles on FABP3

Similar Products

Product Notes

The FABP3 fabp3 (Catalog #AAA9139935) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VDAFLGTWKL VDSKNFDDYM KSLGVGFATR QVASMTKPTT IIEKNGDILT LKTHSTFKNT EISFKLGVEF DETTADDRKV KSIVTLDGGK LVHLQKWDGQ ETTLVRELID GKLILTLTHG TAVCTRTYEK EA. It is sometimes possible for the material contained within the vial of "FABP3/H-FABP, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.